Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRenin
LigandBDBM50003193
Substrate/Competitorn/a
Meas. Tech.ChEMBL_195749
pH7.4±n/a
IC50 330±n/a nM
Commentsextracted
Citation Weber, AESteiner, MGKrieter, PAColletti, AETata, JRHalgren, TABall, RGDoyle, JJSchorn, TWStearns, RA Highly potent, orally active diester macrocyclic human renin inhibitors. J Med Chem35:3755-73 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Renin
Name:Renin
Synonyms:Angiotensinogenase
Type:Enzyme
Mol. Mass.:45058.99
Organism:Homo sapiens (human)
Description:n/a
Residue:406
Sequence:
MDGWRRMPRWGLLLLLWGSCTFGLPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEW
SQPMKRLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRL
YTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEM
PALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGG
QIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISG
STSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKK
LCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50003193
NameBDBM50003193
Synonyms:(diastereomer-1) [1-(6-Cyclohexylmethyl-7-hydroxy-10-isobutyl-4,8,14-trioxo-1,9-dioxa-5-aza-cyclotetradec-3-ylcarbamoyl)-2-phenyl-ethyl]-carbamic acid tert-butyl ester | (diastereomer-2) [1-(6-Cyclohexylmethyl-7-hydroxy-10-isobutyl-4,8,14-trioxo-1,9-dioxa-5-aza-cyclotetradec-3-ylcarbamoyl)-2-phenyl-ethyl]-carbamic acid tert-butyl ester | CHEMBL126153
TypeSmall organic molecule
Emp. Form.C36H55N3O9
Mol. Mass.673.8366
SMILESCC(C)CC1CCCC(=O)OC[C@H](NC(=O)C(Cc2ccccc2)NC(=O)OC(C)(C)C)C(=O)N[C@@H](CC2CCCCC2)[C@@H](O)C(=O)O1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a