Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin 2 (5-HT2) receptor
LigandBDBM50002195
Substrate/Competitorn/a
Meas. Tech.ChEBML_2126
Ki>1000±n/a nM
Citation Gilligan, PJCain, GAChristos, TECook, LDrummond, SJohnson, ALKergaye, AAMcElroy, JFRohrbach, KWSchmidt, WK Novel piperidine sigma receptor ligands as potential antipsychotic drugs. J Med Chem35:4344-61 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serotonin 2 (5-HT2) receptor
Name:Serotonin 2 (5-HT2) receptor
Synonyms:n/a
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of ChEMBL is 2124
Components:This complex has 3 components.
Component 1
Name:Dopamine D2 receptor/Serotonin 2 (5-HT2) receptor
Synonyms:5-HT2C | 5-hydroxytryptamine receptor 2C | Dopamine D2 receptor/Serotonin 2 (5-HT2) receptor | HTR2C | Serotonin 2c (5-HT2c) receptor
Type:Enzyme
Mol. Mass.:51948.16
Organism:Mus musculus (Mouse)
Description:P34968
Residue:459
Sequence:
MVNLGTAVRSLLVHLIGLLVWQFDISISPVAAIVTDTFNSSDGGRLFQFPDGVQNWPALS
IVVIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYV
WPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVW
AISIGVSVPIPVIGLRDESKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYFLTIY
VLRRQTLMLLRGHTEEELRNISLNFLKCCCKKGDEEENAPNPNPDQKPRRKKKEKRPRGT
MQAINNEKKASKVLGIVFFVFLIMWCPFFITNILSVLCGKACNQKLMEKLLNVFVWIGYV
CSGINPLVYTLFNKIYRRAFSKYLRCDYKPDKKPPVRQIPRVAATALSGRELNVNIYRHT
NERVVRKANDTEPGIEMQVENLELPVNPSNVVSERISSV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Dopamine D2 receptor/Serotonin 2 (5-HT2) receptor
Synonyms:5-HT-2 | 5-HT-2A | 5-hydroxytryptamine receptor 2A | Serotonin 2a (5-HT2a) receptor
Type:Enzyme
Mol. Mass.:52843.00
Organism:Mus musculus (Mouse)
Description:P35363
Residue:471
Sequence:
MEILCEDNISLSSIPNSLMQLGDDSRLYPNDFNSRDANTSEASNWTIDAENRTNLSCEGY
LPPTCLSILHLQEKNWSALLTTVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD
MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP
IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF
VAFFIPLTIMVITYFLTIKSLQKEATLCVSDLSTRAKLSSFSFLPQSSLSSEKLFQRSIH
REPGSYAGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNENVIGA
LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENRKPLQLILVNTIPTLAYK
SSQLQVGQKKNSQEDAEPTANDCSMVTLGNQHSEEMCTDNIETVNEKVSCV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 3
Name:Dopamine D2 receptor/Serotonin 2 (5-HT2) receptor
Synonyms:5-HT2 | 5-HT2B | 5-hydroxytryptamine receptor 2B | HTR2B
Type:Enzyme
Mol. Mass.:53610.91
Organism:Mus musculus (Mouse)
Description:Q02152
Residue:479
Sequence:
MASSYKMSEQSTTSEHILQKTCDHLILTNRSGLETDSVAEEMKQTVEGQGHTVHWAALLI
LAVIIPTIGGNILVILAVALEKRLQYATNYFLMSLAIADLLVGLFVMPIALLTIMFEAIW
PLPLALCPAWLFLDVLFSTASIMHLCAISLDRYIAIKKPIQANQCNSRATAFIKITVVWL
ISIGIAIPVPIKGIETDVINPHNVTCELTKDRFGSFMVFGSLAAFFAPLTIMVVTYFLTI
HTLQKKAYLVKNKPPQRLTRWTVPTVFLREDSSFSSPEKVAMLDGSHRDKILPNSSDETL
MRRMSSVGKRSAQTISNEQRASKALGVVFFLFLLMWCPFFITNLTLALCDSCNQTTLKTL
LEIFVWIGYVSSGVNPLIYTLFNKTFREAFGRYITCNYRATKSVKALRKFSSTLCFGNSM
VENSKFFTKHGIRNGINPAMYQSPMRLRSSTIQSSSIILLDTLLTENDGDKAEEQVSYI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50002195
NameBDBM50002195
Synonyms:2-(1-Benzyl-piperidin-4-yl)-1-(4-hydroxy-phenyl)-ethanone;0.25hydrate | CHEMBL344240
TypeSmall organic molecule
Emp. Form.C20H23NO2
Mol. Mass.309.4021
SMILESOc1ccc(cc1)C(=O)CC1CCN(Cc2ccccc2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a