Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDopamine D2 receptor
LigandBDBM50002292
Substrate/Competitorn/a
Meas. Tech.ChEBML_58197
IC50>10000±n/a nM
Citation Gilligan, PJCain, GAChristos, TECook, LDrummond, SJohnson, ALKergaye, AAMcElroy, JFRohrbach, KWSchmidt, WK Novel piperidine sigma receptor ligands as potential antipsychotic drugs. J Med Chem35:4344-61 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dopamine D2 receptor
Name:Dopamine receptor
Synonyms:D(2) dopamine receptor | DOPAMINE D2 | DRD2 | Dopamine Receptor D2 | Dopamine receptor | Dopamine2-like
Type:Enzyme
Mol. Mass.:50957.64
Organism:Mus musculus (Mouse)
Description:P61168
Residue:444
Sequence:
MDPLNLSWYDDDLERQNWSRPFNGSEGKPDRPHYNYYAMLLTLLIFIIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPLLFGLNNTDQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRKRRKRVNTKRSSRAFRANLKTPL
KGNCTHPEDMKLCTVIMKSNGSFPVNRRRMDAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSNPDSPAKPEKNGHAKIVNPRIAKFFEIQTMPNGKTRTSLKTMS
RRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNS
AVNPIIYTTFNIEFRKAFMKILHC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50002292
NameBDBM50002292
Synonyms:4-[4-(4-Fluoro-benzyloxymethyl)-piperidin-1-ylmethyl]-pyridine; compound with but-2-enedioic acid | CHEMBL134684
TypeSmall organic molecule
Emp. Form.C19H23FN2O
Mol. Mass.314.3971
SMILESFc1ccc(COCC2CCN(Cc3ccncc3)CC2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a