Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSigma
LigandBDBM50002264
Substrate/Competitorn/a
Meas. Tech.ChEBML_201877
Ki 5±n/a nM
Citation Gilligan, PJCain, GAChristos, TECook, LDrummond, SJohnson, ALKergaye, AAMcElroy, JFRohrbach, KWSchmidt, WK Novel piperidine sigma receptor ligands as potential antipsychotic drugs. J Med Chem35:4344-61 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sigma
Name:Opioid receptor
Synonyms:Opioid receptor | Opioid receptor, sigma 1 | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:25246.51
Organism:n/a
Description:Sigma 0 0::O55242
Residue:223
Sequence:
MPWAAGRRWAWITLILTIIAVLIQAAWLWLGTQNFVFSREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCILHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWKEGTTKSEVFYPGETVVHGPGEATALEWGPNTWMVEYGRGVIPS
TLFFALADTFFSTQDYLTLFYTLRAYARGLRLELTTYLFGQDS
 
BDBM50002264
NameBDBM50002264
Synonyms:2-(1-Benzyl-piperidin-4-yl)-1-thiophen-2-yl-ethanol;0.25hydrate | CHEMBL139370
TypeSmall organic molecule
Emp. Form.C18H23NOS
Mol. Mass.301.446
SMILESOC(CC1CCN(Cc2ccccc2)CC1)c1cccs1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a