Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMu-type opioid receptor
LigandBDBM50001712
Substrate/Competitorn/a
Meas. Tech.ChEBML_146240
IC50 2.8±n/a nM
Citation Klein, PNelson, WL O3-(2-carbomethoxyallyl) ethers of opioid ligands derived from oxymorphone, naltrexone, etorphine, diprenorphine, norbinaltorphimine, and naltrindole. Unexpected O3-dealkylation in the opioid radioligand displacement assay. J Med Chem35:4589-94 (1993) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Mu-type opioid receptor
Name:Mu-type opioid receptor
Synonyms:M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1
Type:Enzyme Catalytic Domain
Mol. Mass.:11165.58
Organism:GUINEA PIG
Description:P97266
Residue:98
Sequence:
YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50001712
NameBDBM50001712
Synonyms:CHEMBL143416 | methyl 2-[4-cyclopropylmethyl-17-hydroxy-10-(2-methyloxycarbonylallyloxy)-12-oxa-4-azapentacyclo[9.6.1.01,13.05,17.07,18]octadeca-7,9,11(18)-trien-14-yloxymethyl]acrylate
TypeSmall organic molecule
Emp. Form.C30H37NO8
Mol. Mass.539.6167
SMILESCOC(=O)C(=C)CO[C@@H]1CC[C@@]2(O)[C@H]3Cc4ccc(OCC(=C)C(=O)OC)c5O[C@@H]1[C@]2(CCN3CC1CC1)c45
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a