Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin 1B/1D receptor
LigandBDBM50001874
Substrate/Competitorn/a
Meas. Tech.ChEBML_1808
Ki 100±n/a nM
Citation Scott, MKMartin, GEDiStefano, DLFedde, CLKukla, MJBarrett, DLBaldy, WJElgin, RJKesslick, JMMathiasen, JR Pyrrole mannich bases as potential antipsychotic agents. J Med Chem35:552-8 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serotonin 1B/1D receptor
Name:Serotonin 1B/1D receptor
Synonyms:5-HT-1B | 5-HT1B | 5-hydroxytryptamine receptor 1B (5HT1B) | Serotonin 1 (5-HT1) receptor | Serotonin receptor 1B
Type:Protein
Mol. Mass.:43173.33
Organism:Rattus norvegicus (Rat)
Description:P28564
Residue:386
Sequence:
MEEQGIQCAPPPPATSQTGVPLANLSHNCSADDYIYQDSIALPWKVLLVALLALITLATT
LSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDF
WLSSDITCCTASIMHLCVIALDRYWAITDAVDYSAKRTPKRAAIMIVLVWVFSISISLPP
FFWRQAKAEEEVLDCFVNTDHVLYTVYSTVGAFYLPTLLLIALYGRIYVEARSRILKQTP
NKTGKRLTRAQLITDSPGSTSSVTSINSRVPEVPSESGSPVYVNQVKVRVSDALLEKKKL
MAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHMAIFDFFNWLGYLNSLI
NPIIYTMSNEDFKQAFHKLIRFKCTG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50001874
NameBDBM50001874
Synonyms:1-{5-[4-(2-Ethyl-phenyl)-piperazin-1-ylmethyl]-1-methyl-1H-pyrrol-2-ylmethyl}-piperidin-2-one | CHEMBL347334
TypeSmall organic molecule
Emp. Form.C24H34N4O
Mol. Mass.394.553
SMILESCCc1ccccc1N1CCN(Cc2ccc(CN3CCCCC3=O)n2C)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a