Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 protease
LigandBDBM50005700
Substrate/Competitorn/a
Meas. Tech.ChEMBL_159480
IC50 26±n/a nM
Citation Tam, TFCarrière, JMacDonald, DCastelhano, ALPliura, DHDewdney, NJThomas, EMBach, CBarnett, JChan, H Intriguing structure-activity relations underlie the potent inhibition of HIV protease by norstatine-based peptides. J Med Chem35:1318-20 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 protease
Name:Human immunodeficiency virus type 1 protease
Synonyms:Pol polyprotein
Type:Enzyme Subunit
Mol. Mass.:10781.16
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50005700
NameBDBM50005700
Synonyms:CHEMBL3085514 | benzyl N-[(1S)-1-{[(2S)-4-[2-(tert-butylcarbamoyl)piperidin-1-yl]-3-hydroxy-4-oxo-1-phenylbutan-2-yl]carbamoyl}-2-carbamoylethyl]carbamate
TypeSmall organic molecule
Emp. Form.C32H43N5O7
Mol. Mass.609.7131
SMILESCC(C)(C)NC(=O)[C@@H]1CCCCN1C(=O)[C@@H](O)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(N)=O)NC(=O)OCc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a