Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPlatelet activating factor receptor
LigandBDBM50006101
Substrate/Competitorn/a
Meas. Tech.ChEBML_221704
IC50 15700±n/a nM
Citation Wissner, ACarroll, MLGreen, KEKerwar, SSPickett, WCSchaub, RETorley, LWWrenn, SKohler, CA Analogues of platelet activating factor. 6. Mono- and bis-aryl phosphate antagonists of platelet activating factor. J Med Chem35:1650-62 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Platelet activating factor receptor
Name:Platelet activating factor receptor
Synonyms:PAF-R | Platelet-activating factor receptor
Type:Protein
Mol. Mass.:39005.63
Organism:Cavia porcellus
Description:n/a
Residue:342
Sequence:
MELNSSSRVDSEFRYTLFPIVYSIIFVLGIIANGYVLWVFARLYPSKKLNEIKIFMVNLT
VADLLFLITLPLWIVYYSNQGNWFLPKFLCNLAGCLFFINTYCSVAFLGVITYNRFQAVK
YPIKTAQATTRKRGIALSLVIWVAIVAAASYFLVMDSTNVVSNKAGSGNITRCFEHYEKG
SKPVLIIHICIVLGFFIVFLLILFCNLVIIHTLLRQPVKQQRNAEVRRRALWMVCTVLAV
FVICFVPHHMVQLPWTLAELGMWPSSNHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKF
RKHLSEKLNIMRSSQKCSRVTTDTGTEMAIPINHTPVNPIKN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50006101
NameBDBM50006101
Synonyms:Phosphoric acid 3-(1,3-dimethyl-thioureidomethyl)-phenyl ester 3-hexadecyloxy-2-methoxy-propyl ester
TypeSmall organic molecule
Emp. Form.C30H54N2O6PS
Mol. Mass.601.799
SMILESCCCCCCCCCCCCCCCCOCC(COP([O-])(=O)Oc1cccc(CN(C)C(=S)NC)c1)OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a