Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5α-Reductase 1 (5α-R1)
LigandBDBM50039306
Substrate/Competitorn/a
Meas. Tech.ChEMBL_205220
Ki 97±n/a nM
Citation Frye, SVHaffner, CDMaloney, PRMook, RADorsey, GFHiner, RNCribbs, CMWheeler, TNRay, JAAndrews, RC 6-Azasteroids: structure-activity relationships for inhibition of type 1 and 2 human 5 alpha-reductase and human adrenal 3 beta-hydroxy-delta 5-steroid dehydrogenase/3-keto-delta 5-steroid isomerase. J Med Chem37:2352-60 (1994) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5α-Reductase 1 (5α-R1)
Name:Steroid 5-alpha-reductase
Synonyms:3-oxo-5-alpha-steroid 4-dehydrogenase 1 | S5AR | SR type 1 | Steroid 5-alpha-reductase | Steroid 5-alpha-reductase 1
Type:Enzyme
Mol. Mass.:29472.80
Organism:Homo sapiens (Human)
Description:P18405
Residue:259
Sequence:
MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQE
LPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMA
IMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGD
TGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWY
LRKFEEYPKFRKIIIPFLF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50039306
NameBDBM50039306
Synonyms:(1S,9aR,11aS)-6-Bromo-9a,11a-dimethyl-7-oxo-2,3,3a,3b,4,5,7,8,9,9a,9b,10,11,11a-tetradecahydro-1H-cyclopenta[i]phenanthridine-1-carboxylic acid diethylamide | CHEMBL307181
TypeSmall organic molecule
Emp. Form.C23H35BrN2O2
Mol. Mass.451.44
SMILESCCN(CC)C(=O)[C@H]1CCC2C3CN=C4C(Br)C(=O)CC[C@]4(C)C3CC[C@]12C |t:13|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a