Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThyrotropin-releasing hormone receptor
LigandBDBM50050531
Substrate/Competitorn/a
Meas. Tech.ChEMBL_207855
Ki 1.2±n/a nM
Citation Rutledge, LDPerlman, JHGershengorn, MCMarshall, GRMoeller, KD Conformationally restricted TRH analogs: a probe for the pyroglutamate region. J Med Chem39:1571-4 (1996) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Thyrotropin-releasing hormone receptor
Name:Thyrotropin-releasing hormone receptor
Synonyms:TRH-R | Thyroliberin receptor | thyrotropin-releasing hormone R1
Type:Enzyme Catalytic Domain
Mol. Mass.:44568.52
Organism:MOUSE
Description:thyrotropin-releasing hormone R1 TRHR MOUSE::P21761
Residue:393
Sequence:
MENDTVSEMNQTELQPQAAVALEYQVVTILLVVIICGLGIVGNIMVVLVVMRTKHMRTPT
NCYLVSLAVADLMVLVAAGLPNITDSIYGSWVYGYVGCLCITYLQYLGINASSCSITAFT
IERYIAICHPIKAQFLCTFSRAKKIIIFVWAFTSIYCMLWFFLLDLNISTYKNAVVVSCG
YKISRNYYSPIYLMDFGVFYVVPMILATVLYGFIARILFLNPIPSDPKENSKMWKNDSIH
QNKNLNLNATNRCFNSTVSSRKQVTKMLAVVVILFALLWMPYRTLVVVNSFLSSPFQENW
FLLFCRICIYLNSAINPVIYNLMSQKFRAAFRKLCNCKQKPTEKAANYSVALNYSVIKES
DRFSTELEDITVTDTYVSTTKVSFDDTCLASEN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50050531
NameBDBM50050531
Synonyms:1-[3-(1-methyl-4-imidazolyl)-2-[2-oxo-(5S)-dihydro-2H-5-pyrrolylcarboxamido]-(2S)-propanoyl]-(2S)-tetrahydro-1H-2-pyrrolecarboxamide | CHEMBL39363
TypeSmall organic molecule
Emp. Form.C17H24N6O4
Mol. Mass.376.4103
SMILESCn1cnc(C[C@H](NC(=O)[C@H]2CCC(=O)N2)C(=O)N2CCC[C@H]2C(N)=O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a