Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGRIA2
LigandBDBM50060629
Substrate/Competitorn/a
Meas. Tech.ChEMBL_90152
Ki 101±n/a nM
Citation Jane, DEHoo, KKamboj, RDeverill, MBleakman, DMandelzys, A Synthesis of willardiine and 6-azawillardiine analogs: pharmacological characterization on cloned homomeric human AMPA and kainate receptor subtypes. J Med Chem40:3645-50 (1997) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
GRIA2
Name:Glutamate receptor AMPA 2/3
Synonyms:AMPA-selective glutamate receptor 2 | GluR-2 | GluR-B | GluR-K2 | Glutamate AMPA 2 | Glutamate receptor 2 | Glutamate receptor ionotropic AMPA | Glutamate receptor ionotropic, AMPA 2
Type:Enzyme Catalytic Domain
Mol. Mass.:98825.96
Organism:Homo sapiens (Human)
Description:Glutamate AMPA 2 GRIA2 HUMAN::P42262
Residue:883
Sequence:
MQKIMHISVLLSPVLWGLIFGVSSNSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTP
HIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDG
THPFVIQMRPDLKGALLSLIEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINV
GNINNDKKDEMYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANL
GFTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTTTIKYTSALT
YDAVQVMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNI
KFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVVVTT
ILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKI
WNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLD
PLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGRETQSSESTNEFGIFNSLWF
SLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDL
SKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGK
YAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLRNAVNLAVLKLNEQGLL
DKLKNKWWYDKGECGSGGGDSKEKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSR
AEAKRMKVAKNAQNINPSSSQNSQNFATYKEGYNVYGIESVKI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50060629
NameBDBM50060629
Synonyms:(S)-2-Amino-3-(6-iodo-3,5-dioxo-4,5-dihydro-3H-[1,2,4]triazin-2-yl)-propionic acid | CHEMBL121553
TypeSmall organic molecule
Emp. Form.C6H7IN4O4
Mol. Mass.326.0486
SMILESN[C@@H](Cn1nc(I)c(=O)[nH]c1=O)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a