Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin 1B/1D receptor
LigandBDBM50060679
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1780
IC50 167±n/a nM
Citation Campiani, GCappelli, ANacci, VAnzini, MVomero, SHamon, MCagnotto, AFracasso, CUboldi, CCaccia, SConsolo, SMennini, T Novel and highly potent 5-HT3 receptor agonists based on a pyrroloquinoxaline structure. J Med Chem40:3670-8 (1997) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serotonin 1B/1D receptor
Name:Serotonin 1B/1D receptor
Synonyms:5-HT-1B | 5-HT1B | 5-hydroxytryptamine receptor 1B (5HT1B) | Serotonin 1 (5-HT1) receptor | Serotonin receptor 1B
Type:Protein
Mol. Mass.:43173.33
Organism:Rattus norvegicus (Rat)
Description:P28564
Residue:386
Sequence:
MEEQGIQCAPPPPATSQTGVPLANLSHNCSADDYIYQDSIALPWKVLLVALLALITLATT
LSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDF
WLSSDITCCTASIMHLCVIALDRYWAITDAVDYSAKRTPKRAAIMIVLVWVFSISISLPP
FFWRQAKAEEEVLDCFVNTDHVLYTVYSTVGAFYLPTLLLIALYGRIYVEARSRILKQTP
NKTGKRLTRAQLITDSPGSTSSVTSINSRVPEVPSESGSPVYVNQVKVRVSDALLEKKKL
MAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHMAIFDFFNWLGYLNSLI
NPIIYTMSNEDFKQAFHKLIRFKCTG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50060679
NameBDBM50060679
Synonyms:7-Fluoro-4-piperazin-1-yl-pyrrolo[1,2-a]quinoxaline | CHEMBL120216
TypeSmall organic molecule
Emp. Form.C15H15FN4
Mol. Mass.270.3048
SMILESFc1ccc2c(c1)nc(N1CCNCC1)c1cccn21
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a