Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMetabotropic glutamate receptor 6 (mGlu6)
LigandBDBM50052551
Substrate/Competitorn/a
Meas. Tech.ChEMBL_104459
EC50 82000±n/a nM
Citation Ahmadian, HNielsen, BBräuner-Osborne, HJohansen, TNStensbøl, TBSløk, FASekiyama, NNakanishi, SKrogsgaard-Larsen, PMadsen, U (S)-homo-AMPA, a specific agonist at the mGlu6 subtype of metabotropic glutamic acid receptors. J Med Chem40:3700-5 (1997) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Metabotropic glutamate receptor 6 (mGlu6)
Name:Metabotropic glutamate receptor 6 (mGlu6)
Synonyms:GRM6 | mGlu6 | mGluR6 | metabotropic glutamate 6
Type:Enzyme
Mol. Mass.:95095.82
Organism:Rattus norvegicus (Rat)
Description:P35349
Residue:871
Sequence:
MGRLPVLLLWLAWWLSQAGIACGAGSVRLAGGLTLGGLFPVHARGAAGRACGALKKEQGV
HRLEAMLYALDRVNADPELLPGVRLGARLLDTCSRDTYALEQALSFVQALIRGRGDGDEA
SVRCPGGVPPLRSAPPERVVAVVGASASSVSIMVANVLRLFAIPQISYASTAPELSDSTR
YDFFSRVVPPDSYQAQAMVDIVRALGWNYVSTLASEGNYGESGVEAFVQISREAGGVCIA
QSIKIPREPKPGEFHKVIRRLMETPNARGIIIFANEDDIRRVLEATRQANLTGHFLWVGS
DSWGSKISPILNLEEEAVGAITILPKRASIDGFDQYFMTRSLENNRRNIWFAEFWEENFN
CKLTSSGGQSDDSTRKCTGEERIGQDSAYEQEGKVQFVIDAVYAIAHALHSMHQALCPGH
TGLCPAMEPTDGRTLLHYIRAVRFNGSAGTPVMFNENGDAPGRYDIFQYQATNGSASSGG
YQAVGQWAEALRLDMEVLRWSGDPHEVPPSQCSLPCGPGERKKMVKGVPCCWHCEACDGY
RFQVDEFTCEACPGDMRPTPNHTGCRPTPVVRLTWSSPWAALPLLLAVLGIMATTTIMAT
FMRHNDTPIVRASGRELSYVLLTGIFLIYAITFLMVAEPCAAICAARRLLLGLGTTLSYS
ALLTKTNRIYRIFEQGKRSVTPPPFISPTSQLVITFGLTSLQVVGVIAWLGAQPPHSVID
YEEQRTVDPEQARGVLKCDMSDLSLIGCLGYSLLLMVTCTVYAIKARGVPETFNEAKPIG
FTMYTTCIIWLAFVPIFFGTAQSAEKIYIQTTTLTVSLSLSASVSLGMLYVPKTYVILFH
PEQNVQKRKRSLKKTSTMAAPPQNENAEDAK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50052551
NameBDBM50052551
Synonyms:2-Amino-4-(3-hydroxy-5-methyl-isoxazol-4-yl)-butyric acid | CHEMBL107768
TypeSmall organic molecule
Emp. Form.C8H12N2O4
Mol. Mass.200.1919
SMILESCc1o[nH]c(=O)c1CCC(N)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a