Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAcetylcholine receptor protein alpha/beta/delta/gamma chain
LigandBDBM50035398
Substrate/Competitorn/a
Meas. Tech.ChEMBL_216976
EC50 411000±n/a nM
Citation Holladay, MWDart, MJLynch, JK Neuronal nicotinic acetylcholine receptors as targets for drug discovery. J Med Chem40:4169-94 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Acetylcholine receptor protein alpha/beta/delta/gamma chain
Name:Acetylcholine receptor protein alpha/beta/delta/gamma chain
Synonyms:Acetylcholine receptor
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of EBI is 143080
Components:This complex has 4 components.
Component 1
Name:Acetylcholine receptor
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:56146.98
Organism:Torpedo californica
Description:EBI_19626
Residue:493
Sequence:
MENVRRMALGLVVMMALALSGVGASVMEDTLLSVLFETYNPKVRPAQTVGDKVTVRVGLT
LTNLLILNEKIEEMTTNVFLNLAWTDYRLQWDPAAYEGIKDLRIPSSDVWQPDIVLMNNN
DGSFEITLHVNVLVQHTGAVSWQPSAIYRSSCTIKVMYFPFDWQNCTMVFKSYTYDTSEV
TLQHALDAKGEREVKEIVINKDAFTENGQWSIEHKPSRKNWRSDDPSYEDVTFYLIIQRK
PLFYIVYTIIPCILISILAILVFYLPPDAGEKMSLSISALLAVTVFLLLLADKVPETSLS
VPIIIRYLMFIMILVAFSVILSVVVLNLHHRSPNTHTMPNWIRQIFIETLPPFLWIQRPV
TTPSPDSKPTIISRANDEYFIRKPAGDFVCPVDNARVAVQPERLFSEMKWHLNGLTQPVT
LPQDLKEAVEAIKYIAEQLESASEFDDLKKDWQYVAMVADRLFLYVFFVICSIGTFSIFL
DASHNVPPDNPFA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Acetylcholine receptor
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:58151.68
Organism:Torpedo californica
Description:EBI_19662
Residue:506
Sequence:
MVLTLLLIICLALEVRSENEEGRLIEKLLGDYDKRIIPAKTLDHIIDVTLKLTLTNLISL
NEKEEALTTNVWIEIQWNDYRLSWNTSEYEGIDLVRIPSELLWLPDVVLENNVDGQFEVA
YYANVLVYNDGSMYWLPPAIYRSTCPIAVTYFPFDWQNCSLVFRSQTYNAHEVNLQLSAE
EGEAVEWIHIDPEDFTENGEWTIRHRPAKKNYNWQLTKDDTDFQEIIFFLIIQRKPLFYI
INIIAPCVLISSLVVLVYFLPAQAGGQKCTLSISVLLAQTIFLFLIAQKVPETSLNVPLI
GKYLIFVMFVSMLIVMNCVIVLNVSLRTPNTHSLSEKIKHLFLGFLPKYLGMQLEPSEET
PEKPQPRRRSSFGIMIKAEEYILKKPRSELMFEEQKDRHGLKRVNKMTSDIDIGTTVDLY
KDLANFAPEIKSCVEACNFIAKSTKEQNDSGSENENWVLIGKVIDKACFWIALLLFSIGT
LAIFLTGHFNQVPEFPFPGDPRKYVP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 3
Name:Acetylcholine receptor
Synonyms:Acetylcholine receptor protein alpha chain
Type:PROTEIN
Mol. Mass.:52735.09
Organism:Torpedo californica
Description:ChEMBL_216981
Residue:461
Sequence:
MILCSYWHVGLVLLLFSCCGLVLGSEHETRLVANLLENYNKVIRPVEHHTHFVDITVGLQ
LIQLISVDEVNQIVETNVRLRQQWIDVRLRWNPADYGGIKKIRLPSDDVWLPDLVLYNNA
DGDFAIVHMTKLLLDYTGKIMWTPPAIFKSYCEIIVTHFPFDQQNCTMKLGIWTYDGTKV
SISPESDRPDLSTFMESGEWVMKDYRGWKHWVYYTCCPDTPYLDITYHFIMQRIPLYFVV
NVIIPCLLFSFLTGLVFYLPTDSGEKMTLSISVLLSLTVFLLVIVELIPSTSSAVPLIGK
YMLFTMIFVISSIIITVVVINTHHRSPSTHTMPQWVRKIFIDTIPNVMFFSTMKRASKEK
QENKIFADDIDISDISGKQVTGEVIFQTPLIKNPDVKSAIEGVKYIAEHMKSDEESSNAA
EEWKYVAMVIDHILLCVFMLICIIGTVSVFAGRLIELSQEG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 4
Name:Acetylcholine receptor
Synonyms:Acetylcholine receptor protein delta chain
Type:PROTEIN
Mol. Mass.:59885.01
Organism:Torpedo californica
Description:ChEMBL_142744
Residue:522
Sequence:
MGNIHFVYLLISCLYYSGCSGVNEEERLINDLLIVNKYNKHVRPVKHNNEVVNIALSLTL
SNLISLKETDETLTSNVWMDHAWYDHRLTWNASEYSDISILRLPPELVWIPDIVLQNNND
GQYHVAYFCNVLVRPNGYVTWLPPAIFRSSCPINVLYFPFDWQNCSLKFTALNYDANEIT
MDLMTDTIDGKDYPIEWIIIDPEAFTENGEWEIIHKPAKKNIYPDKFPNGTNYQDVTFYL
IIRRKPLFYVINFITPCVLISFLASLAFYLPAESGEKMSTAISVLLAQAVFLLLTSQRLP
ETALAVPLIGKYLMFIMSLVTGVIVNCGIVLNFHFRTPSTHVLSTRVKQIFLEKLPRILH
MSRADESEQPDWQNDLKLRRSSSVGYISKAQEYFNIKSRSELMFEKQSERHGLVPRVTPR
IGFGNNNENIAASDQLHDEIKSGIDSTNYIVKQIKEKNAYDEEVGNWNLVGQTIDRLSMF
IITPVMVLGTIFIFVMGNFNHPPAKPFEGDPFDYSSDHPRCA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50035398
NameBDBM50035398
Synonyms:(S)-1-Methyl-2-(3-methyl-isoxazol-5-yl)-pyrrolidinium | (S)-3-methyl-5-(1-methylpyrrolidin-2-yl)isoxazole | 3-Methyl-5-((S)-1-methyl-pyrrolidin-2-yl)-isoxazole | ABT-418 | CHEMBL274525
TypeSmall organic molecule
Emp. Form.C9H14N2O
Mol. Mass.166.2203
SMILESCN1CCC[C@H]1c1cc(C)no1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a