Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDopamine D2 receptor/Serotonin 2 (5-HT2) receptor
LigandBDBM50061636
Substrate/Competitorn/a
Meas. Tech.ChEMBL_62884
Ki 0.300000±n/a nM
Citation Mewshaw, REKavanagh, JStack, GMarquis, KLShi, XKagan, MZWebb, MBKatz, AHPark, AKang, YHAbou-Gharbia, MScerni, RWasik, TCortes-Burgos, LSpangler, TBrennan, JAPiesla, MMazandarani, HCockett, MIOchalski, RCoupet, JAndree, TH New generation dopaminergic agents. 1. Discovery of a novel scaffold which embraces the D2 agonist pharmacophore. Structure-activity relationships of a series of 2-(aminomethyl)chromans. J Med Chem40:4235-56 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dopamine D2 receptor/Serotonin 2 (5-HT2) receptor
Name:Dopamine D2 receptor and Serotonin 2a receptor (D2 and 5HT2a)
Synonyms:DOPAMINE D2 | DOPAMINE D2 Long | DOPAMINE D2 Short | DOPAMINE D2/D4 | DRD2 | Dopamine D2 receptor | Dopamine2-like
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:50931.60
Organism:Rattus norvegicus (rat)
Description:Receptor binding assays were performed using rat striatal membranes.
Residue:444
Sequence:
MDPLNLSWYDDDLERQNWSRPFNGSEGKADRPHYNYYAMLLTLLIFIIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPLLFGLNNTDQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRKRRKRVNTKRSSRAFRANLKTPL
KGNCTHPEDMKLCTVIMKSNGSFPVNRRRMDAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSNPDSPAKPEKNGHAKIVNPRIAKFFEIQTMPNGKTRTSLKTMS
RRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNS
AVNPIIYTTFNIEFRKAFMKILHC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50061636
NameBDBM50061636
Synonyms:2-{[3-(3-Amino-4-chloro-phenoxy)-propylamino]-methyl}-chroman-7-ol; oxalic acid | CHEMBL135201
TypeSmall organic molecule
Emp. Form.C19H23ClN2O3
Mol. Mass.362.851
SMILESNc1cc(OCCCNCC2CCc3ccc(O)cc3O2)ccc1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a