Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin (5-HT) receptor
LigandBDBM50061649
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1413
Ki 0.19±n/a nM
Citation Mewshaw, REKavanagh, JStack, GMarquis, KLShi, XKagan, MZWebb, MBKatz, AHPark, AKang, YHAbou-Gharbia, MScerni, RWasik, TCortes-Burgos, LSpangler, TBrennan, JAPiesla, MMazandarani, HCockett, MIOchalski, RCoupet, JAndree, TH New generation dopaminergic agents. 1. Discovery of a novel scaffold which embraces the D2 agonist pharmacophore. Structure-activity relationships of a series of 2-(aminomethyl)chromans. J Med Chem40:4235-56 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serotonin (5-HT) receptor
Name:Serotonin 1 (5-HT1) receptor
Synonyms:5-HT-1A | 5-HT1 | 5-HT1A | 5-Hydroxytryptamine receptor 1A (5-HT1A) | 5-hydroxytryptamine receptor 1A | 5-hydroxytryptamine receptor 1A (5HT1A) | G-21 | Serotonin 1a (5-HT1a) receptor/Adrenergic receptor alpha-1 | Serotonin receptor 1A
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:46445.29
Organism:Rattus norvegicus (rat)
Description:Binding assays were performed using rat hippocampal membranes.
Residue:422
Sequence:
MDVFSFGQGNNTTASQEPFGTGGNVTSISDVTFSYQVITSLLLGTLIFCAVLGNACVVAA
IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC
TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED
RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVRKVEKKGAGT
SLGTSSAPPPKKSLNGQPGSGDWRRCAENRAVGTPCTNGAVRQGDDEATLEVIEVHRVGN
SKEHLPLPSESGSNSYAPACLERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP
FFIVALVLPFCESSCHMPALLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC
RR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50061649
NameBDBM50061649
Synonyms:2-{[3-(Benzooxazol-5-yloxy)-propylamino]-methyl}-chroman-7-ol; oxalic acid | CHEMBL134677
TypeSmall organic molecule
Emp. Form.C20H22N2O4
Mol. Mass.354.3997
SMILESOc1ccc2CCC(CNCCCOc3ccc4ocnc4c3)Oc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a