Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target3-beta-hydroxysteroid dehydrogenase/delta 5-->4-isomerase type I
LigandBDBM50031877
Substrate/Competitorn/a
Meas. Tech.ChEMBL_329
Ki 1600±n/a nM
Citation Kenny, BBallard, SBlagg, JFox, D Pharmacological options in the treatment of benign prostatic hyperplasia. J Med Chem40:1293-315 (1997) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
3-beta-hydroxysteroid dehydrogenase/delta 5-->4-isomerase type I
Name:3-beta-hydroxysteroid dehydrogenase/delta 5-->4-isomerase type I
Synonyms:3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1 | 3-beta-HSD I | 3-beta-hydroxy-5-ene steroid dehydrogenase | 3-beta-hydroxy-Delta(5)-steroid dehydrogenase | Delta-5-3-ketosteroid isomerase | Progesterone reductase | Trophoblast antigen FDO161G
Type:PROTEIN
Mol. Mass.:42261.17
Organism:Homo sapiens (Human)
Description:ChEMBL_329
Residue:373
Sequence:
MTGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQNKTKLTVLE
GDILDEPFLKRACQDVSVIIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVF
IYTSSIEVAGPNSYKEIIQNGHEEEPLENTWPAPYPHSKKLAEKAVLAANGWNLKNGGTL
YTCALRPMYIYGEGSRFLSASINEALNNNGILSSVGKFSTVNPVYVGNVAWAHILALRAL
QDPKKAPSIRGQFYYISDDTPHQSYDNLNYTLSKEFGLRLDSRWSFPLSLMYWIGFLLEI
VSFLLRPIYTYRPPFNRHIVTLSNSVFTFSYKKAQRDLAYKPLYSWEEAKQKTVEWVGSL
VDRHKETLKSKTQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50031877
NameBDBM50031877
Synonyms:(1S,9aR,11aS)-9a,11a-Dimethyl-7-oxo-2,3,3a,3b,4,5,7,8,9,9a,9b,10,11,11a-tetradecahydro-1H-cyclopenta[i]phenanthridine-1-carboxylic acid (2-tert-butyl-5-trifluoromethyl-phenyl)-amide | CHEMBL277224
TypeSmall organic molecule
Emp. Form.C30H39F3N2O2
Mol. Mass.516.6381
SMILESCC(C)(C)c1ccc(cc1NC(=O)[C@H]1CCC2C3CN=C4CC(=O)CC[C@]4(C)C3CC[C@]12C)C(F)(F)F |t:20|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a