Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSRC
LigandBDBM50077208
Substrate/Competitorn/a
Meas. Tech.ChEMBL_221635
Kd 40±n/a nM
Citation Beaulieu, PLCameron, DRFerland, JMGauthier, JGhiro, EGillard, JGorys, VPoirier, MRancourt, JWernic, DLlinas-Brunet, MBetageri, RCardozo, MHickey, ERIngraham, RJakes, SKabcenell, AKirrane, TLukas, SPatel, UProudfoot, JSharma, RTong, LMoss, N Ligands for the tyrosine kinase p56lck SH2 domain: discovery of potent dipeptide derivatives with monocharged, nonhydrolyzable phosphate replacements. J Med Chem42:1757-66 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
SRC
Name:SRC
Synonyms:LCK | LSK | Lymphocyte cell-specific protein-tyrosine kinase | Lymphocyte-specific protein tyrosine kinase | P56-LCK | Proto-oncogene tyrosine-protein kinase LCK | T cell-specific protein-tyrosine kinase | Tyrosine-protein kinase Lck
Type:Enzyme
Mol. Mass.:57987.83
Organism:Homo sapiens (human)
Description:P06239
Residue:509
Sequence:
MGCGCSSHPEDDWMENIDVCENCHYPIVPLDGKGTLLIRNGSEVRDPLVTYEGSNPPASP
LQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKAN
SLEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKH
YKIRNLDNGGFYISPRITFPGLHELVRHYTNASDGLCTRLSRPCQTQKPQKPWWEDEWEV
PRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHQRL
VRLYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLTINKLLDMAAQIAEGMAFIEERNY
IHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIK
SDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEELYQLMRLCWKER
PEDRPTFDYLRSVLEDFFTATEGQYQPQP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50077208
NameBDBM50077208
Synonyms:(S)-4-(4-Methoxy-benzylcarbamoyl)-4-[(S)-2-(2-naphthalen-1-yl-acetylamino)-3-(4-phosphonooxy-phenyl)-propionylamino]-butyric acid | CHEMBL50965
TypeSmall organic molecule
Emp. Form.C34H36N3O10P
Mol. Mass.677.6375
SMILESCOc1ccc(CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](Cc2ccc(OP(O)(O)=O)cc2)NC(=O)Cc2cccc3ccccc23)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a