Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAICAR transformylase
LigandBDBM22579
Substrate/Competitorn/a
Meas. Tech.ChEMBL_28428
IC50 25000±n/a nM
Citation Wall, MShim, JHBenkovic, SJ A multisubstrate adduct inhibitor of AICAR transformylase. J Med Chem42:3421-4 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
AICAR transformylase
Name:Thymidylate synthase/GAR transformylase/AICAR transformylase
Synonyms:5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase | 5-aminoimidazole-4-carboxamide-ribonucleotide transformylase | ATIC | Aminoimidazole carboxamide ribonucleotide transformylase (AICAR Tfase) | Bifunctional purine biosynthesis protein PURH | IMP cyclohydrolase | IMP synthetase | Inosinicase | Phosphoribosylaminoimidazolecarboxamide formyltransferase
Type:Protein
Mol. Mass.:64616.62
Organism:Homo sapiens (Human)
Description:P31939
Residue:592
Sequence:
MAPGQLALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEM
LGGRVKTLHPAVHAGILARNIPEDNADMARLDFNLIRVVACNLYPFVKTVASPGVTVEEA
VEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVVVSTEMQSSESKDTSLETRRQLALKAFT
HTAQYDEAISDYFRKQYSKGVSQMPLRYGMNPHQTPAQLYTLQPKLPITVLNGAPGFINL
CDALNAWQLVKELKEALGIPAAASFKHVSPAGAAVGIPLSEDEAKVCMVYDLYKTLTPIS
AAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILSKKKNG
NYCVLQMDQSYKPDENEVRTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIV
ATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKT
GVKRAEISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDA
FFPFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIILAHTNLRLFHH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22579
NameBDBM22579
Synonyms:AICAR | Aminoimidazole-4-carboxamide ribonucleotide | CHEMBL483849 | ZMP | {[(2R,3S,4R,5R)-5-(5-amino-4-carbamoyl-1H-imidazol-1-yl)-3,4-dihydroxyoxolan-2-yl]methoxy}phosphonic acid
TypeNucleoside or nucleotide
Emp. Form.C9H15N4O8P
Mol. Mass.338.2112
SMILESNC(=O)c1ncn([C@@H]2O[C@H](COP(O)(O)=O)[C@@H](O)[C@H]2O)c1N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a