Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMatrix metalloproteinase-7 (MMP7)
LigandBDBM50082556
Substrate/Competitorn/a
Meas. Tech.ChEMBL_102105
Ki 54±n/a nM
Citation Almstead, NGBradley, RSPikul, SDe, BNatchus, MGTaiwo, YOGu, FWilliams, LEHynd, BAJanusz, MJDunaway, CMMieling, GE Design, synthesis, and biological evaluation of potent thiazine- and thiazepine-based matrix metalloproteinase inhibitors. J Med Chem42:4547-62 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Matrix metalloproteinase-7 (MMP7)
Name:Matrix metalloproteinase 7
Synonyms:Matrix metalloproteinase 7 | Matrix metalloproteinase-7 (MMP-7)
Type:Enzyme
Mol. Mass.:29681.54
Organism:Homo sapiens (Human)
Description:P09237
Residue:267
Sequence:
MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLK
EMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDL
PHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAF
APGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGD
PQNFKLSQDDIKGIQKLYGKRSNSRKK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50082556
NameBDBM50082556
Synonyms:(S)-2,2-Dimethyl-4-[4-(pyridin-4-yloxy)-benzenesulfonyl]-thiomorpholine-3-carboxylic acid hydroxyamide | (S)-N-hydroxy-2,2-dimethyl-4-(4-(pyridin-4-yloxy)phenylsulfonyl)thiomorpholine-3-carboxamide | 2,2-Dimethyl-4-[4-(pyridin-4-yloxy)-benzenesulfonyl]-thiomorpholine-3-carboxylic acid hydroxyamide | 2,2-Dimethyl-4-[4-(pyridin-4-yloxy)-benzenesulfonyl]-thiomorpholine-3-carboxylic acid hydroxyamide(AG 3340) | 2,2-Dimethyl-4-[4-(pyridin-4-yloxy)-benzenesulfonyl]-thiomorpholine-3-carboxylic acid hydroxyamide(prinomastat) | AG-3340 | CHEMBL75094 | Prinomastat
TypeSmall organic molecule
Emp. Form.C18H21N3O5S2
Mol. Mass.423.506
SMILESCC1(C)SCCN([C@H]1C(=O)NO)S(=O)(=O)c1ccc(Oc2ccncc2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a