Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelanocortin receptor 1
LigandBDBM50034912
Substrate/Competitorn/a
Meas. Tech.ChEMBL_219174
EC50 4540±n/a nM
Citation Haskell-Luevano, CHolder, JRMonck, EKBauzo, RM Characterization of melanocortin NDP-MSH agonist peptide fragments at the mouse central and peripheral melanocortin receptors. J Med Chem44:2247-52 (2001) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Melanocortin receptor 1
Name:Melanocortin receptor 1
Synonyms:MC1-R | MSH-R | Melanocyte-stimulating hormone receptor
Type:PROTEIN
Mol. Mass.:35238.60
Organism:Mus musculus
Description:ChEMBL_1498846
Residue:315
Sequence:
MSTQEPQKSLLGSLNSNATSHLGLATNQSEPWCLYVSIPDGLFLSLGLVSLVENVLVVIA
ITKNRNLHSPMYYFICCLALSDLMVSVSIVLETTIILLLEAGILVARVALVQQLDNLIDV
LICGSMVSSLCFLGIIAIDRYISIFYALRYHSIVTLPRARRAVVGIWMVSIVSSTLFITY
YKHTAVLLCLVTFFLAMLALMAILYAHMFTRACQHAQGIAQLHKRRRSIRQGFCLKGAAT
LTILLGIFFLCWGPFFLHLLLIVLCPQHPTCSCIFKNFNLFLLLIVLSSTVDPLIYAFRS
QELRMTLKEVLLCSW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50034912
NameBDBM50034912
Synonyms:(S)-2-((R)-2-Acetylamino-3-phenyl-propionylamino)-5-guanidino-pentanoic acid [(S)-1-carbamoyl-2-(1H-indol-3-yl)-ethyl]-amide | Ac-DPhe-Arg-Trp-NH2 | CHEMBL432895
TypeSmall organic molecule
Emp. Form.C28H36N8O4
Mol. Mass.548.6366
SMILESCC(=O)N[C@H](Cc1ccccc1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a