Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine transporter 1
LigandBDBM50105143
Substrate/Competitorn/a
Meas. Tech.ChEMBL_149711
Ki 29000±n/a nM
Citation Klenke, BStewart, MBarrett, MPBrun, RGilbert, IH Synthesis and biological evaluation of s-triazine substituted polyamines as potential new anti-trypanosomal drugs. J Med Chem44:3440-52 (2001) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine transporter 1
Name:Adenosine transporter 1
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:51044.02
Organism:Trypanosoma brucei
Description:ChEMBL_31141
Residue:463
Sequence:
MLGFDSANEFIVYVTFLFFGMSVVVVTNSIFSMPFFFIEYYKYAQGKPDAKPEDPKFWKH
MFTYYSIAAFLVELVLASLMLTPIGRRISVTVRLGVGLVIPIVLVFSVMMVTIVTTTETG
AKVTIMLIAIANGVAMTLCDAGNAALIAPFPTKFYSSVVWGIAVCGVVTSFFSIVIKASM
GGGYHNMLIQSRIYFGLVMFMQVISCALLVLLRKNPYAQKYAAEFRYAARKGIDDKGADG
DEGNGAAKGPADQDDDPHGGDDTDKGNVMTATVDPDTMKDMDQVENITTSQQMLMARVWN
VFWRVWPMLFACFMVFFTTFLVYPAVYFAIKADTGDGWYLTIAAALFNLGDFLSRLCLQF
KALHVSPRWVLIGTFARMLLIIPLVLCVRSIITGPWLPYILVHAWGFTYGYYGGISQIYA
PRTGSLTTAGERSLAANWTIISLLGGIFVGAMFALAVNEGLPK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50105143
NameBDBM50105143
Synonyms:CHEMBL544116 | N2-(3-((9-((3-((4,6-Di(dimethylamino)-1,3,5-triazin-2-yl)amino)propyl)amino)nonyl)amino)-propyl)N4,N4,N6,N6-tetramethyl-1,3,5-triazine-4,2,6-triamine pentaahydrochloride
TypeSmall organic molecule
Emp. Form.C29H58N14
Mol. Mass.602.8646
SMILESCN(C)c1nc(NCCCNCCCCCCCCCNCCCNc2nc(nc(n2)N(C)C)N(C)C)nc(n1)N(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a