Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine transporter 1
LigandBDBM50105135
Substrate/Competitorn/a
Meas. Tech.ChEMBL_149711
Ki 135±n/a nM
Citation Klenke, BStewart, MBarrett, MPBrun, RGilbert, IH Synthesis and biological evaluation of s-triazine substituted polyamines as potential new anti-trypanosomal drugs. J Med Chem44:3440-52 (2001) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine transporter 1
Name:Adenosine transporter 1
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:51044.02
Organism:Trypanosoma brucei
Description:ChEMBL_31141
Residue:463
Sequence:
MLGFDSANEFIVYVTFLFFGMSVVVVTNSIFSMPFFFIEYYKYAQGKPDAKPEDPKFWKH
MFTYYSIAAFLVELVLASLMLTPIGRRISVTVRLGVGLVIPIVLVFSVMMVTIVTTTETG
AKVTIMLIAIANGVAMTLCDAGNAALIAPFPTKFYSSVVWGIAVCGVVTSFFSIVIKASM
GGGYHNMLIQSRIYFGLVMFMQVISCALLVLLRKNPYAQKYAAEFRYAARKGIDDKGADG
DEGNGAAKGPADQDDDPHGGDDTDKGNVMTATVDPDTMKDMDQVENITTSQQMLMARVWN
VFWRVWPMLFACFMVFFTTFLVYPAVYFAIKADTGDGWYLTIAAALFNLGDFLSRLCLQF
KALHVSPRWVLIGTFARMLLIIPLVLCVRSIITGPWLPYILVHAWGFTYGYYGGISQIYA
PRTGSLTTAGERSLAANWTIISLLGGIFVGAMFALAVNEGLPK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50105135
NameBDBM50105135
Synonyms:CHEMBL542936 | N2-(3-((12-((3-((4Amino,6-(methylamino)-1,3,5-triazin-2-yl)amino)propyl)amino)dodecyl)amino)-propyl)N4-methyl-1,3,5-triazine-4,2,6-triamine pentaahydrochloride
TypeSmall organic molecule
Emp. Form.C26H52N14
Mol. Mass.560.7849
SMILESCNc1nc(N)nc(NCCCNCCCCCCCCCCCCNCCCNc2nc(N)nc(NC)n2)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a