Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine transporter 1
LigandBDBM50105121
Substrate/Competitorn/a
Meas. Tech.ChEMBL_149711
Ki 750±n/a nM
Citation Klenke, BStewart, MBarrett, MPBrun, RGilbert, IH Synthesis and biological evaluation of s-triazine substituted polyamines as potential new anti-trypanosomal drugs. J Med Chem44:3440-52 (2001) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine transporter 1
Name:Adenosine transporter 1
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:51044.02
Organism:Trypanosoma brucei
Description:ChEMBL_31141
Residue:463
Sequence:
MLGFDSANEFIVYVTFLFFGMSVVVVTNSIFSMPFFFIEYYKYAQGKPDAKPEDPKFWKH
MFTYYSIAAFLVELVLASLMLTPIGRRISVTVRLGVGLVIPIVLVFSVMMVTIVTTTETG
AKVTIMLIAIANGVAMTLCDAGNAALIAPFPTKFYSSVVWGIAVCGVVTSFFSIVIKASM
GGGYHNMLIQSRIYFGLVMFMQVISCALLVLLRKNPYAQKYAAEFRYAARKGIDDKGADG
DEGNGAAKGPADQDDDPHGGDDTDKGNVMTATVDPDTMKDMDQVENITTSQQMLMARVWN
VFWRVWPMLFACFMVFFTTFLVYPAVYFAIKADTGDGWYLTIAAALFNLGDFLSRLCLQF
KALHVSPRWVLIGTFARMLLIIPLVLCVRSIITGPWLPYILVHAWGFTYGYYGGISQIYA
PRTGSLTTAGERSLAANWTIISLLGGIFVGAMFALAVNEGLPK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50105121
NameBDBM50105121
Synonyms:CHEMBL542204 | N2-(3-((9-((3-((4-Amino-6-(methylamino)-1,3,5-triazin-2-yl)amino)propyl)amino)nonyl)amino)-propyl)N4-methyl-1,3,5-triazine-4,2,6-triamine Tetrahydrochloride
TypeSmall organic molecule
Emp. Form.C23H46N14
Mol. Mass.518.7051
SMILESCNc1nc(N)nc(NCCCNCCCCCCCCCNCCCNc2nc(N)nc(NC)n2)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a