Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFatty acid-binding protein 4 (FABP4)
LigandBDBM50250904
Substrate/Competitorn/a
Meas. Tech.ChEMBL_29917
Kd 58000±n/a nM
Citation Cozzini, PFornabaio, MMarabotti, AAbraham, DJKellogg, GEMozzarelli, A Simple, intuitive calculations of free energy of binding for protein-ligand complexes. 1. Models without explicit constrained water. J Med Chem45:2469-83 (2002) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Fatty acid-binding protein 4 (FABP4)
Name:Fatty acid-binding protein 4 (FABP4)
Synonyms:A-FABP | AFABP | ALBP | Adipocyte lipid-binding protein | Fatty acid binding protein adipocyte | Fatty acid-binding protein 4
Type:Enzyme
Mol. Mass.:14719.23
Organism:Homo sapiens (Human)
Description:P15090
Residue:132
Sequence:
MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKN
TEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVM
KGVTSTRVYERA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50250904
NameBDBM50250904
Synonyms:CHEMBL460657 | Elaidinsaeure | elaidic acid | trans-Delta(9)-octadecenoic acid
TypeSmall organic molecule
Emp. Form.C18H34O2
Mol. Mass.282.4614
SMILESCCCCCCCC\C=C\CCCCCCCC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a