Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelanocortin receptor 5 (MC5R)
LigandBDBM50115374
Substrate/Competitorn/a
Meas. Tech.ChEMBL_104264
EC50 11200±n/a nM
Citation Holder, JRBauzo, RMXiang, ZHaskell-Luevano, C Structure-activity relationships of the melanocortin tetrapeptide Ac-His-DPhe-Arg-Trp-NH(2) at the mouse melanocortin receptors: part 2 modifications at the Phe position. J Med Chem45:3073-81 (2002) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Melanocortin receptor 5 (MC5R)
Name:Melanocortin receptor 5
Synonyms:Melanocortin receptor 5
Type:Enzyme
Mol. Mass.:36966.58
Organism:Mus musculus (Mouse)
Description:P41149
Residue:325
Sequence:
MNSSSTLTVLNLTLNASEDGILGSNVKNKSLACEEMGIAVEVFLTLGLVSLLENILVIGA
IVKNKNLHSPMYFFVGSLAVADMLVSMSNAWETVTIYLLNNKHLVIADTFVRHIDNVFDS
MICISVVASMCSLLAIAVDRYITIFYALRYHHIMTARRSGVIIACIWTFCISCGIVFIIY
YESKYVIICLISMFFTMLFFMVSLYIHMFLLARNHVKRIAASPRYNSVRQRTSMKGAITL
TMLLGIFIVCWSPFFLHLILMISCPQNVYCSCFMSYFNMYLILIMCNSVIDPLIYALRSQ
EMRRTFKEIVCCHGFRRPCRLLGGY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50115374
NameBDBM50115374
Synonyms:2-{2-[2-Acetylamino-3-(3H-imidazol-4-yl)-propionylamino]-3-naphthalen-1-yl-propionylamino}-5-guanidino-pentanoic acid [1-carbamoyl-2-(1H-indol-3-yl)-ethyl]-amide | CHEMBL319922
TypeSmall organic molecule
Emp. Form.C38H45N11O5
Mol. Mass.735.8346
SMILESCC(=O)N[C@@H](Cc1cnc[nH]1)C(=O)N[C@@H](Cc1cccc2ccccc12)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a