Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A2a and A3
LigandBDBM50118808
Substrate/Competitorn/a
Meas. Tech.ChEMBL_30467
Ki 1.3±n/a nM
Citation Gao, ZGKim, SKBiadatti, TChen, WLee, KBarak, DKim, SGJohnson, CRJacobson, KA Structural determinants of A(3) adenosine receptor activation: nucleoside ligands at the agonist/antagonist boundary. J Med Chem45:4471-84 (2002) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A2a and A3
Name:Adenosine receptor A2a and A3
Synonyms:Adenosine A3 receptor
Type:PROTEIN
Mol. Mass.:36643.73
Organism:Rattus norvegicus
Description:ChEMBL_479910
Residue:320
Sequence:
MKANNTTTSALWLQITYITMEAAIGLCAVVGNMLVIWVVKLNRTLRTTTFYFIVSLALAD
IAVGVLVIPLAIAVSLEVQMHFYACLFMSCVLLVFTHASIMSLLAIAVDRYLRVKLTVRY
RTVTTQRRIWLFLGLCWLVSFLVGLTPMFGWNRKVTLELSQNSSTLSCHFRSVVGLDYMV
FFSFITWILIPLVVMCIIYLDIFYIIRNKLSQNLTGFRETRAFYGREFKTAKSLFLVLFL
FALCWLPLSIINFVSYFNVKIPEIAMCLGILLSHANSMMNPIVYACKIKKFKETYFVILR
ACRLCQTSDSLDSNLEQTTE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50118808
NameBDBM50118808
Synonyms:4-[2-Chloro-6-(3-iodo-benzylamino)-purin-9-yl]-1-hydroxymethyl-bicyclo[3.1.0]hexane-2,3-diol | CHEMBL342873
TypeSmall organic molecule
Emp. Form.C19H19ClIN5O3
Mol. Mass.527.743
SMILESOCC12CC1C(C(O)C2O)n1cnc2c(NCc3cccc(I)c3)nc(Cl)nc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a