Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelanocortin receptor 3
LigandBDBM50122073
Substrate/Competitorn/a
Meas. Tech.ChEMBL_106838
EC50 3500±n/a nM
Citation Holder, JRXiang, ZBauzo, RMHaskell-Luevano, C Structure-activity relationships of the melanocortin tetrapeptide Ac-His-D-Phe-Arg-Trp-NH2 at the mouse melanocortin receptors. 4. Modifications at the Trp position. J Med Chem45:5736-44 (2002) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Melanocortin receptor 3
Name:Melanocortin receptor 3
Synonyms:MC3-R
Type:PROTEIN
Mol. Mass.:35808.24
Organism:Mus musculus
Description:ChEMBL_1498848
Residue:323
Sequence:
MNSSCCLSSVSPMLPNLSEHPAAPPASNRSGSGFCEQVFIKPEVFLALGIVSLMENILVI
LAVVRNGNLHSPMYFFLCSLAAADMLVSLSNSLETIMIAVINSDSLTLEDQFIQHMDNIF
DSMICISLVASICNLLAIAIDRYVTIFYALRYHSIMTVRKALTLIGVIWVCCGICGVMFI
IYSESKMVIVCLITMFFAMVLLMGTLYIHMFLFARLHVQRIAVLPPAGVVAPQQHSCMKG
AVTITILLGVFIFCWAPFFLHLVLIITCPTNPYCICYTAHFNTYLVLIMCNSVIDPLIYA
FRSLELRNTFKEILCGCNSMNLG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50122073
NameBDBM50122073
Synonyms:Ac-His-D-Phe-Arg-Nal(1')-NH2 | CHEMBL154153
TypeSmall organic molecule
Emp. Form.C36H44N10O5
Mol. Mass.696.7986
SMILESCC(=O)N[C@@H](Cc1cnc[nH]1)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@H](Cc1cccc2ccccc12)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a