Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelanocortin receptor 5 (MC5R)
LigandBDBM50122076
Substrate/Competitorn/a
Meas. Tech.ChEMBL_104262
EC50 12.1±n/a nM
Citation Holder, JRXiang, ZBauzo, RMHaskell-Luevano, C Structure-activity relationships of the melanocortin tetrapeptide Ac-His-D-Phe-Arg-Trp-NH2 at the mouse melanocortin receptors. 4. Modifications at the Trp position. J Med Chem45:5736-44 (2002) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Melanocortin receptor 5 (MC5R)
Name:Melanocortin receptor 5
Synonyms:Melanocortin receptor 5
Type:Enzyme
Mol. Mass.:36966.58
Organism:Mus musculus (Mouse)
Description:P41149
Residue:325
Sequence:
MNSSSTLTVLNLTLNASEDGILGSNVKNKSLACEEMGIAVEVFLTLGLVSLLENILVIGA
IVKNKNLHSPMYFFVGSLAVADMLVSMSNAWETVTIYLLNNKHLVIADTFVRHIDNVFDS
MICISVVASMCSLLAIAVDRYITIFYALRYHHIMTARRSGVIIACIWTFCISCGIVFIIY
YESKYVIICLISMFFTMLFFMVSLYIHMFLLARNHVKRIAASPRYNSVRQRTSMKGAITL
TMLLGIFIVCWSPFFLHLILMISCPQNVYCSCFMSYFNMYLILIMCNSVIDPLIYALRSQ
EMRRTFKEIVCCHGFRRPCRLLGGY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50122076
NameBDBM50122076
Synonyms:Ac-His-D-Phe-Arg-D-Nal(2')-NH2 | CHEMBL347216
TypeSmall organic molecule
Emp. Form.C36H44N10O5
Mol. Mass.696.7986
SMILESCC(=O)N[C@@H](Cc1cnc[nH]1)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](Cc1ccc2ccccc2c1)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a