Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelanocortin receptor 4
LigandBDBM50122068
Substrate/Competitorn/a
Meas. Tech.ChEMBL_104251
EC50 43700±n/a nM
Citation Holder, JRXiang, ZBauzo, RMHaskell-Luevano, C Structure-activity relationships of the melanocortin tetrapeptide Ac-His-D-Phe-Arg-Trp-NH2 at the mouse melanocortin receptors. 4. Modifications at the Trp position. J Med Chem45:5736-44 (2002) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Melanocortin receptor 4
Name:Melanocortin receptor 4
Synonyms:MC4-R
Type:PROTEIN
Mol. Mass.:36964.43
Organism:Mus musculus
Description:ChEMBL_1498850
Residue:332
Sequence:
MNSTHHHGMYTSLHLWNRSSYGLHGNASESLGKGHPDGGCYEQLFVSPEVFVTLGVISLL
ENILVIVAIAKNKNLHSPMYFFICSLAVADMLVSVSNGSETIVITLLNSTDTDAQSFTVN
IDNVIDSVICSSLLASICSLLSIAVDRYFTIFYALQYHNIMTVRRVGIIISCIWAACTVS
GVLFIIYSDSSAVIICLISMFFTMLVLMASLYVHMFLMARLHIKRIAVLPGTGTIRQGTN
MKGAITLTILIGVFVVCWAPFFLHLLFYISCPQNPYCVCFMSHFNLYLILIMCNAVIDPL
IYALRSQELRKTFKEIICFYPLGGICELSSRY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50122068
NameBDBM50122068
Synonyms:Ac-His-D-Phe-Arg-Ala-NH2 | CHEMBL359318
TypeSmall organic molecule
Emp. Form.C26H38N10O5
Mol. Mass.570.6439
SMILESCC(NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](Cc1cnc[nH]1)NC(C)=O)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a