Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetOpioid receptors; mu & delta
LigandBDBM50108916
Substrate/Competitorn/a
Meas. Tech.ChEMBL_146919
Ki 0.13±n/a nM
Citation Balboni, GGuerrini, RSalvadori, SBianchi, CRizzi, DBryant, SDLazarus, LH Evaluation of the Dmt-Tic pharmacophore: conversion of a potent delta-opioid receptor antagonist into a potent delta agonist and ligands with mixed properties. J Med Chem45:713-20 (2002) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Opioid receptors; mu & delta
Name:Opioid receptors; mu & delta
Synonyms:Cytochrome P450 3A4 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor | Delta-type opioid receptor (DOR) | OPIATE Delta | Opiate Delta 1 | Opioid receptor | Opioid receptor A | Voltage-gated potassium channel
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:40465.04
Organism:Rattus norvegicus (rat)
Description:Competition binding assays were using CHO-K1 cell membranes expressing the opioid receptor.
Residue:372
Sequence:
MEPVPSARAELQFSLLANVSDTFPSAFPSASANASGSPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTQPRDGAVVCTLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRAPCGGQEPGSLRRPRQATARERVTAC
TPSDGPGGGAAA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50108916
NameBDBM50108916
Synonyms:2-Amino-1-[3-(1H-benzoimidazol-2-yl)-3,4-dihydro-1H-isoquinolin-2-yl]-3-(4-hydroxy-2,6-dimethyl-phenyl)-propan-1-one
TypeSmall organic molecule
Emp. Form.C27H28N4O2
Mol. Mass.440.5368
SMILESCc1cc(O)cc(C)c1C[C@H](N)C(=O)N1Cc2ccccc2CC1c1nc2ccccc2[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a