Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMatrix metalloproteinase-1 (MMP1)
LigandBDBM50128635
Substrate/Competitorn/a
Meas. Tech.ChEMBL_106291
IC50 7060±n/a nM
Citation Aranapakam, VDavis, JMGrosu, GTBaker, JEllingboe, JZask, ALevin, JISandanayaka, VPDu, MSkotnicki, JSDiJoseph, JFSung, ASharr, MAKillar, LMWalter, TJin, GCowling, RTillett, JZhao, WMcDevitt, JXu, ZB Synthesis and structure-activity relationship of N-substituted 4-arylsulfonylpiperidine-4-hydroxamic acids as novel, orally active matrix metalloproteinase inhibitors for the treatment of osteoarthritis. J Med Chem46:2376-96 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Matrix metalloproteinase-1 (MMP1)
Name:Matrix metalloproteinase (1 and 13)
Synonyms:Fibroblast collagenase | Interstitial collagenase | MMP1 | Matrix metalloproteinase-1 | Matrix metalloproteinase-1 (MMP-1)
Type:Enzyme
Mol. Mass.:54010.26
Organism:Homo sapiens (Human)
Description:
Residue:469
Sequence:
MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPV
VEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIEN
YTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGN
LAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSY
TFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDR
FYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGY
PKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFP
GIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50128635
NameBDBM50128635
Synonyms:4-(4-Butoxy-benzenesulfonyl)-1-ethyl-piperidine-4-carboxylic acid hydroxyamide | 4-(4-butoxyphenylsulfonyl)-1-ethyl-N-hydroxypiperidine-4-carboxamide | CHEMBL79111
TypeSmall organic molecule
Emp. Form.C18H28N2O5S
Mol. Mass.384.49
SMILESCCCCOc1ccc(cc1)S(=O)(=O)C1(CCN(CC)CC1)C(=O)NO
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a