Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVoltage-gated potassium channel subunit Kv7.1
LigandBDBM50099582
Substrate/Competitorn/a
Meas. Tech.ChEMBL_88893
IC50 120±n/a nM
Citation Wermuth, CG Selective optimization of side activities: another way for drug discovery. J Med Chem47:1303-14 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Voltage-gated potassium channel subunit Kv7.1
Name:Voltage-gated potassium channel subunit Kv7.1
Synonyms:IKs producing slow voltage-gated potassium channel subunit alpha KvLQT1 | KQT-like 1 | Potassium voltage-gated channel subfamily KQT member 1
Type:PROTEIN
Mol. Mass.:74450.11
Organism:Cavia porcellus
Description:ChEMBL_88894
Residue:671
Sequence:
MAAASSPPRTERKRGGWGRLLGSRRGSASLAKKCPFSLELAEGGPAGGTLYAPVAPPGAL
SPGSPAPPASPAAPPAGLELGPRPPVSLDPRVSIYSARRPLLARTHIQGRVYNFLERPTG
WKCFVYHFAVFLIVLACLIFSVLSTIEQYAALATGTLFWMEIVLVVFFGTEYVVRLWSAG
CRSKYVGIWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGIRFLQILRML
HVDRQGGTWRLLGSVVFIHRQELITTLYIGFLGLIFSSYFVYLAEKDAVNESGRVEFGSY
ADALWWGVVTVTTIGYGDKVPQTWVGKTIASCFSVFAISFFALPAGILGSGFALKVQQKQ
RQKHFNRQIPAAASLIQTAWRCYAAENPDSSTWKIYVRKPARSHTLLSPSPKPKKSAMVR
KKKFKPDKDNGVSPGEKMLTVPHITCDPPEERRPDHFSVDGYDSSVRKSPTLLEVSPTHF
MRTNSFAEDLDLEGETLLTPITHVSQLREHHRATIKVIRRMQYFVAKKKFQQARKPYDVR
DVIEQYSQGHLNLMVRIKELQRRLDQSIGKPSLFIPISEKSKDRGSNTIGARLNRVEDKV
TQLDQRLVVITDMLHQLLSLHQGGPHSGGGPQMVQPCSEDGSIHPELFLPSNSLPTYEQL
TVPQRGPDEAS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50099582
NameBDBM50099582
Synonyms:(3R,4S)N-[3-Hydroxy-2,2-dimethyl-6-(4,4,4-trifluoro-butoxy)-chroman-4-yl]-N-methyl-methanesulfonamide | CHEMBL298475 | N-[(3R,4S)-3-Hydroxy-2,2-dimethyl-6-(4,4,4-trifluoro-butoxy)-chroman-4-yl]-N-methyl-methanesulfonamide | N-[3-Hydroxy-2,2-dimethyl-6-(4,4,4-trifluoro-butoxy)-chroman-4-yl]-N-methyl-methanesulfonamide
TypeSmall organic molecule
Emp. Form.C17H24F3NO5S
Mol. Mass.411.436
SMILESCN([C@@H]1[C@@H](O)C(C)(C)Oc2ccc(OCCCC(F)(F)F)cc12)S(C)(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a