Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase
LigandBDBM26981
Substrate/Competitorn/a
Meas. Tech.ChEMBL_302990
Ki 13200000±n/a nM
Citation Innocenti, AZimmerman, SFerry, JGScozzafava, ASupuran, CT Carbonic anhydrase inhibitors. Inhibition of the beta-class enzyme from the methanoarchaeon Methanobacterium thermoautotrophicum (Cab) with anions. Bioorg Med Chem Lett14:4563-7 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase
Name:Carbonic anhydrase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:19556.84
Organism:Methanobacterium thermoautotrophicum
Description:ChEMBL_1280426
Residue:176
Sequence:
MRFVSMIIKDILRENQDFRFRDLSDLKHSPKLCIITCMDSRLIDLLERALGIGRGDAKVI
KNAGNIVDDGVIRSAAVAIYALGVNEIIIVGHTDCGMARLDEDLIVSRMRELGVEEEVIE
NFSIDVLNPVGDEEENVIEGVKRLKSSPLIPESIGVHGLIIDINTGRLKPLYLDED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26981
NameBDBM26981
Synonyms:CHEMBL1644695 | CHEMBL185537 | I- | IODIDE | POTASSIUM IODIDE | iodide | iodide ion
TypeIon
Emp. Form.I
Mol. Mass.126.90502
SMILES[I-]
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a