Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGamma-carbonic anhydrase
LigandBDBM26992
Substrate/Competitorn/a
Meas. Tech.ChEMBL_302701
Ki 11700000±n/a nM
Citation Innocenti, AZimmerman, SFerry, JGScozzafava, ASupuran, CT Carbonic anhydrase inhibitors. Inhibition of the beta-class enzyme from the methanoarchaeon Methanobacterium thermoautotrophicum (Cab) with anions. Bioorg Med Chem Lett14:4563-7 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Gamma-carbonic anhydrase
Name:Gamma-carbonic anhydrase
Synonyms:CAM | Carbonic anhydrase
Type:Protein
Mol. Mass.:26390.56
Organism:Methanosarcina thermophila
Description:P40881
Residue:247
Sequence:
MMFNKQIFTILILSLSLALAGSGCISEGAEDNVAQEITVDEFSNIRENPVTPWNPEPSAP
VIDPTAYIDPQASVIGEVTIGANVMVSPMASIRSDEGMPIFVGDRSNVQDGVVLHALETI
NEEGEPIEDNIVEVDGKEYAVYIGNNVSLAHQSQVHGPAAVGDDTFIGMQAFVFKSKVGN
NCVLEPRSAAIGVTIPDGRYIPAGMVVTSQAEADKLPEVTDDYAYSHTNEAVVYVNVHLA
EGYKETS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26992
NameBDBM26992
Synonyms:CHEMBL183495 | SO4(2-) | SODIUM SULFATE | sulfate | sulfate ion
TypeIon
Emp. Form.O4S
Mol. Mass.96.064
SMILES[O-]S([O-])(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a