Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target1-deoxyxylulose-5-phosphate reductoisomerase
LigandBDBM50153713
Substrate/Competitorn/a
Meas. Tech.ChEMBL_302829
Ki 21±n/a nM
Citation Phaosiri, CProteau, PJ Substrate analogs for the investigation of deoxyxylulose 5-phosphate reductoisomerase inhibition: synthesis and evaluation. Bioorg Med Chem Lett14:5309-12 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
1-deoxyxylulose-5-phosphate reductoisomerase
Name:1-deoxyxylulose-5-phosphate reductoisomerase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:42517.94
Organism:Synechocystis sp. (strain PCC 6803)
Description:ChEMBL_303054
Residue:394
Sequence:
MVKRISILGSTGSIGTQTLDIVTHHPDAFQVVGLAAGGNVALLAQQVAEFRPEIVAIRQA
EKLEDLKAAVAELTDYQPMYVVGEEGVVEVARYGDAESVVTGIVGCAGLLPTMAAIAAGK
DIALANKETLIAGAPVVLPLVEKMGVKLLPADSEHSAIFQCLQGVPEGGLRRIILTASGG
AFRDLPVERLPFVTVQDALKHPNWSMGQKITIDSATLMNKGLEVIEAHYLFGLDYDHIDI
VIHPQSIIHSLIEVQDTSVLAQLGWPDMRLPLLYALSWPERIYTDWEPLDLVKAGSLSFR
EPDHDKYPCMQLAYGAGRAGGAMPAVLNAANEQAVALFLQEKISFLDIPRLIEKTCDLYV
GQNTASPDLETILAADQWARRTVLENSACVATRP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50153713
NameBDBM50153713
Synonyms:3-(N-hydroxyformamido)propylphosphonic acid | 3-[FORMYL(HYDROXY)AMINO]PROPYLPHOSPHONIC ACID | CHEMBL203125 | [3-(Formyl-hydroxy-amino)-propyl]-phosphonic acid | fosmidomycin
TypeSmall organic molecule
Emp. Form.C4H10NO5P
Mol. Mass.183.0997
SMILESON(CCCP(O)(O)=O)C=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a