Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCdc25C
LigandBDBM50155597
Substrate/Competitorn/a
Meas. Tech.ChEMBL_305864
IC50 3900±n/a nM
Citation Contour-Galcéra, MOLavergne, OBrezak, MCDucommun, BPrévost, G Synthesis of small molecule CDC25 phosphatases inhibitors. Bioorg Med Chem Lett14:5809-12 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cdc25C
Name:Cdc25C
Synonyms:Dual specificity phosphatase Cdc25C | M-phase inducer phosphatase 3
Type:Substrate
Mol. Mass.:53366.11
Organism:Homo sapiens (Human)
Description:P30307
Residue:473
Sequence:
MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANL
SILSGGTPKRCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMK
CSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNP
NLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDK
VKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQGHLIGDFSKVCALPTVSGKHQ
DLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNFFLKK
PIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFF
PEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50155597
n/a
NameBDBM50155597
Synonyms:4-Dimethylamino-2-{[2-(4-nitro-phenyl)-ethylamino]-methyl}-phenol | CHEMBL186631
TypeSmall organic molecule
Emp. Form.C17H21N3O3
Mol. Mass.315.3669
SMILESCN(C)c1ccc(O)c(CNCCc2ccc(cc2)[N+]([O-])=O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: