Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-glucosidase A
LigandBDBM50156361
Substrate/Competitorn/a
Meas. Tech.ChEMBL_305641
IC50 100000±n/a nM
Citation Godin, GCompain, PMartin, ORIkeda, KYu, LAsano, N Alpha-1-C-alkyl-1-deoxynojirimycin derivatives as potent and selective inhibitors of intestinal isomaltase: remarkable effect of the alkyl chain length on glycosidase inhibitory profile. Bioorg Med Chem Lett14:5991-5 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Beta-glucosidase A
Name:Beta-glucosidase A
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:53484.21
Organism:Caldocellum saccharolyticum
Description:ChEMBL_37437
Residue:455
Sequence:
MDMSFPKGFLWGAATASYQIEGAWNEDGKGESIWDRFTHQKRNILYGHNGDVACDHYHRF
EEDVSLMKELGLKAYRFSIAWTRIFPDGFGTVNQKGLEFYDRLINKLVENGIEPVVTLYH
WDLPQKLQDIGGWANPEIVNYYFDYAMLVINRYKDKVKKWITFNEPYCIAFLGYFHGIHA
PGIKDFKVAMDVVHSLMLSHFKVVKAVKENNIDVEVGITLNLTPVYLQTERLGYKVSEIE
REMVSLSSQLDNQLFLDPVLKGSYPQKLLDYLVQKDLLDSQKALSMQQEVKENFIFPDFL
GINYYTRAVRLYDENSSWIFPIRWEHPAGEYTEMGWEVFPQGLFDLLIWIKESYPQIPIY
ITENGAAYNDIVTEDGKVHDSKRIEYLKQHFEAARKAIENGVDLRGYFVWSLMDNFEWAM
GYTKRFGIIYVDYETQKRIKKDSFYFYQQYIKENS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50156361
NameBDBM50156361
Synonyms:2-Hydroxymethyl-1-propyl-piperidine-3,4,5-triol | CHEMBL362754
TypeSmall organic molecule
Emp. Form.C9H19NO4
Mol. Mass.205.2515
SMILESCCCN1CC(O)C(O)C(O)C1CO
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a