Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGamma-carbonic anhydrase
LigandBDBM50079047
Substrate/Competitorn/a
Meas. Tech.ChEMBL_303240
Ki 170±n/a nM
Citation Zimmerman, SInnocenti, ACasini, AFerry, JGScozzafava, ASupuran, CT Carbonic anhydrase inhibitors. Inhibition of the prokariotic beta and gamma-class enzymes from Archaea with sulfonamides. Bioorg Med Chem Lett14:6001-6 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Gamma-carbonic anhydrase
Name:Gamma-carbonic anhydrase
Synonyms:CAM | Carbonic anhydrase
Type:Protein
Mol. Mass.:26390.56
Organism:Methanosarcina thermophila
Description:P40881
Residue:247
Sequence:
MMFNKQIFTILILSLSLALAGSGCISEGAEDNVAQEITVDEFSNIRENPVTPWNPEPSAP
VIDPTAYIDPQASVIGEVTIGANVMVSPMASIRSDEGMPIFVGDRSNVQDGVVLHALETI
NEEGEPIEDNIVEVDGKEYAVYIGNNVSLAHQSQVHGPAAVGDDTFIGMQAFVFKSKVGN
NCVLEPRSAAIGVTIPDGRYIPAGMVVTSQAEADKLPEVTDDYAYSHTNEAVVYVNVHLA
EGYKETS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50079047
NameBDBM50079047
Synonyms:3-Amino-benzenesulfonamide | 3-aminobenzenesulfonamide | CHEMBL6852
TypeSmall organic molecule
Emp. Form.C6H8N2O2S
Mol. Mass.172.205
SMILESNc1cccc(c1)S(N)(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a