Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGamma-carbonic anhydrase
LigandBDBM11639
Substrate/Competitorn/a
Meas. Tech.ChEMBL_303240
Ki 140±n/a nM
Citation Zimmerman, SInnocenti, ACasini, AFerry, JGScozzafava, ASupuran, CT Carbonic anhydrase inhibitors. Inhibition of the prokariotic beta and gamma-class enzymes from Archaea with sulfonamides. Bioorg Med Chem Lett14:6001-6 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Gamma-carbonic anhydrase
Name:Gamma-carbonic anhydrase
Synonyms:CAM | Carbonic anhydrase
Type:Protein
Mol. Mass.:26390.56
Organism:Methanosarcina thermophila
Description:P40881
Residue:247
Sequence:
MMFNKQIFTILILSLSLALAGSGCISEGAEDNVAQEITVDEFSNIRENPVTPWNPEPSAP
VIDPTAYIDPQASVIGEVTIGANVMVSPMASIRSDEGMPIFVGDRSNVQDGVVLHALETI
NEEGEPIEDNIVEVDGKEYAVYIGNNVSLAHQSQVHGPAAVGDDTFIGMQAFVFKSKVGN
NCVLEPRSAAIGVTIPDGRYIPAGMVVTSQAEADKLPEVTDDYAYSHTNEAVVYVNVHLA
EGYKETS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM11639
NameBDBM11639
Synonyms:4-[5-(4-methylphenyl)-3-(trifluoromethyl)-1H-pyrazol-1-yl]benzene-1-sulfonamide | CHEMBL118 | CLX | Celebrex | Celecoxib | US8741944, Comparative Compound | US9388139, Celecoxib | cid_2662
TypeSmall organic molecule
Emp. Form.C17H14F3N3O2S
Mol. Mass.381.372
SMILESCc1ccc(cc1)-c1cc(nn1-c1ccc(cc1)S(N)(=O)=O)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a