Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGamma-carbonic anhydrase
LigandBDBM10882
Substrate/Competitorn/a
Meas. Tech.ChEMBL_303239
Ki 740±n/a nM
Citation Zimmerman, SInnocenti, ACasini, AFerry, JGScozzafava, ASupuran, CT Carbonic anhydrase inhibitors. Inhibition of the prokariotic beta and gamma-class enzymes from Archaea with sulfonamides. Bioorg Med Chem Lett14:6001-6 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Gamma-carbonic anhydrase
Name:Gamma-carbonic anhydrase
Synonyms:CAM | Carbonic anhydrase
Type:Protein
Mol. Mass.:26390.56
Organism:Methanosarcina thermophila
Description:P40881
Residue:247
Sequence:
MMFNKQIFTILILSLSLALAGSGCISEGAEDNVAQEITVDEFSNIRENPVTPWNPEPSAP
VIDPTAYIDPQASVIGEVTIGANVMVSPMASIRSDEGMPIFVGDRSNVQDGVVLHALETI
NEEGEPIEDNIVEVDGKEYAVYIGNNVSLAHQSQVHGPAAVGDDTFIGMQAFVFKSKVGN
NCVLEPRSAAIGVTIPDGRYIPAGMVVTSQAEADKLPEVTDDYAYSHTNEAVVYVNVHLA
EGYKETS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10882
NameBDBM10882
Synonyms:6-ethoxy-1,3-benzothiazole-2-sulfonamide | CHEMBL18 | Ethamide | Ethoxazolamide | Ethoxzolamide | Ethoxzolamide (EZA) | Ethoxzolamide, EZM | Sulfonamide, 3 | US10172837, Ethoxyzolamide | sulfonamide 3
TypeSmall organic molecule
Emp. Form.C9H10N2O3S2
Mol. Mass.258.317
SMILESCCOc1ccc2nc(sc2c1)S(N)(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a