Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPlasminogen
LigandBDBM50157341
Substrate/Competitorn/a
Meas. Tech.ChEBML_302435
Ki 23000±n/a nM
Citation Ueno, HYokota, KHoshi, JYasue, KHayashi, MUchida, IAisaka, KHase, YKatoh, SCho, H Discovery of novel tetrahydroisoquinoline derivatives as potent and selective factor Xa inhibitors. Bioorg Med Chem Lett15:185-9 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Plasminogen
Name:Plasminogen
Synonyms:Activation peptide | Angiostatin | Plasmin | Plasmin heavy chain A | Plasmin heavy chain A, short form | Plasmin light chain B
Type:Enzyme
Mol. Mass.:90579.18
Organism:Homo sapiens (Human)
Description:n/a
Residue:810
Sequence:
MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFT
CRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKN
GITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILE
CEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRE
LRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWS
AQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTE
QLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAG
LTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEED
CMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGG
PWCYTTNPRKLYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRT
RFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLE
PTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQ
LPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSW
GLGCARPNKPGVYVRVSRFVTWIEGVMRNN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50157341
NameBDBM50157341
Synonyms:3-(2-Carbamimidoyl-isoquinolin-7-yl)-2-{4-[1-(1-imino-ethyl)-pyrrolidin-3-yloxy]-phenyl}-propionic acid; pentahydrate ; hydrochloride | CHEMBL180677
TypeSmall organic molecule
Emp. Form.C25H28N5O3
Mol. Mass.446.521
SMILESCC(=N)N1CCC(C1)Oc1ccc(cc1)C(Cc1ccc2cc[n+](cc2c1)C(N)=N)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a