Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhosphodiesterase 7
LigandBDBM50027176
Substrate/Competitorn/a
Meas. Tech.ChEMBL_302392
Ki 4000±n/a nM
Citation Manallack, DTHughes, RAThompson, PE The next generation of phosphodiesterase inhibitors: structural clues to ligand and substrate selectivity of phosphodiesterases. J Med Chem48:3449-62 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Phosphodiesterase 7
Name:Phosphodiesterase 7
Synonyms:n/a
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of ChEMBL is 302392
Components:This complex has 2 components.
Component 1
Name:cAMP-specific 3',5'-cyclic phosphodiesterase 7B
Synonyms:Phosphodiesterase 7B | Phosphodiesterase 7B (PDE7B)
Type:Enzyme
Mol. Mass.:51842.76
Organism:Homo sapiens (Human)
Description:Q9NP56
Residue:450
Sequence:
MSCLMVERCGEILFENPDQNAKCVCMLGDIRLRGQTGVRAERRGSYPFIDFRLLNSTTYS
GEIGTKKKVKRLLSFQRYFHASRLLRGIIPQAPLHLLDEDYLGQARHMLSKVGMWDFDIF
LFDRLTNGNSLVTLLCHLFNTHGLIHHFKLDMVTLHRFLVMVQEDYHSQNPYHNAVHAAD
VTQAMHCYLKEPKLASFLTPLDIMLGLLAAAAHDVDHPGVNQPFLIKTNHHLANLYQNMS
VLENHHWRSTIGMLRESRLLAHLPKEMTQDIEQQLGSLILATDINRQNEFLTRLKAHLHN
KDLRLEDAQDRHFMLQIALKCADICNPCRIWEMSKQWSERVCEEFYRQGELEQKFELEIS
PLCNQQKDSIPSIQIGFMSYIVEPLFREWAHFTGNSTLSENMLGHLAHNKAQWKSLLPRQ
HRSRGSSGSGPDHDHAGQGTESEEQEGDSP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:3',5'-cyclic phosphodiesterase
Synonyms:Phosphodiesterase 7 (PDE7) | Phosphodiesterase 7A | Phosphodiesterase 7A (PDE7A1)
Type:Enzyme
Mol. Mass.:55514.96
Organism:Homo sapiens (Human)
Description:Q13946
Residue:482
Sequence:
MEVCYQLPVLPLDRPVPQHVLSRRGAISFSSSSALFGCPNPRQLSQRRGAISYDSSDQTA
LYIRMLGDVRVRSRAGFESERRGSHPYIDFRIFHSQSEIEVSVSARNIRRLLSFQRYLRS
SRFFRGTAVSNSLNILDDDYNGQAKCMLEKVGNWNFDIFLFDRLTNGNSLVSLTFHLFSL
HGLIEYFHLDMMKLRRFLVMIQEDYHSQNPYHNAVHAADVTQAMHCYLKEPKLANSVTPW
DILLSLIAAATHDLDHPGVNQPFLIKTNHYLATLYKNTSVLENHHWRSAVGLLRESGLFS
HLPLESRQQMETQIGALILATDISRQNEYLSLFRSHLDRGDLCLEDTRHRHLVLQMALKC
ADICNPCRTWELSKQWSEKVTEEFFHQGDIEKKYHLGVSPLCDRHTESIANIQIGFMTYL
VEPLFTEWARFSNTRLSQTMLGHVGLNKASWKGLQREQSSSEDTDAAFELNSQLLPQENR
LS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50027176
NameBDBM50027176
Synonyms:2-Acetoxy-Benzoic Acid | 3-Isobutyl-Methylxanthine | CHEBI:34795 | ISOBUTYLMETHYLXANTHINE
TypeSmall organic molecule
Emp. Form.C10H14N4O2
Mol. Mass.222.2438
SMILESCC(C)Cn1c2[nH]cnc2c(=O)n(C)c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a