Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFatty-acid amide hydrolase 1
LigandBDBM50100865
Substrate/Competitorn/a
Meas. Tech.ChEMBL_302502
Ki 2.3±n/a nM
Citation Lambert, DMFowler, CJ The endocannabinoid system: drug targets, lead compounds, and potential therapeutic applications. J Med Chem48:5059-87 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Fatty-acid amide hydrolase 1
Name:Fatty-acid amide hydrolase 1
Synonyms:Anandamide amidohydrolase | Anandamide amidohydrolase 1 | FAAH | FAAH1 | Fatty Acid Amide Hydrolase (FAAH) | Fatty-acid amide hydrolase (FAAH) | Oleamide hydrolase 1
Type:Protein
Mol. Mass.:63071.19
Organism:Homo sapiens (Human)
Description:O00519
Residue:579
Sequence:
MVQYELWAALPGASGVALACCFVAAAVALRWSGRRTARGAVVRARQRQRAGLENMDRAAQ
RFRLQNPDLDSEALLALPLPQLVQKLHSRELAPEAVLFTYVGKAWEVNKGTNCVTSYLAD
CETQLSQAPRQGLLYGVPVSLKECFTYKGQDSTLGLSLNEGVPAECDSVVVHVLKLQGAV
PFVHTNVPQSMFSYDCSNPLFGQTVNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGG
SIRFPSSFCGICGLKPTGNRLSKSGLKGCVYGQEAVRLSVGPMARDVESLALCLRALLCE
DMFRLDPTVPPLPFREEVYTSSQPLRVGYYETDNYTMPSPAMRRAVLETKQSLEAAGHTL
VPFLPSNIPHALETLSTGGLFSDGGHTFLQNFKGDFVDPCLGDLVSILKLPQWLKGLLAF
LVKPLLPRLSAFLSNMKSRSAGKLWELQHEIEVYRKTVIAQWRALDLDVVLTPMLAPALD
LNAPGRATGAVSYTMLYNCLDFPAGVVPVTTVTAEDEAQMEHYRGYFGDIWDKMLQKGMK
KSVGLPVAVQCVALPWQEELCLRFMREVERLMTPEKQSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50100865
NameBDBM50100865
Synonyms:(Z)-1-(oxazolo[4,5-b]pyridin-2-yl)octadec-9-en-1-one | (Z)-1-Oxazolo[4,5-b]pyridin-2-yl-octadec-9-en-1-one | 1-Oxazolo[4,5-b]pyridin-2-yl-nonadec-10-en-2-one | CHEMBL35925
TypeSmall organic molecule
Emp. Form.C24H36N2O2
Mol. Mass.384.5548
SMILESCCCCCCCC\C=C/CCCCCCCC(=O)c1nc2ncccc2o1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a