Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLiver glycogen phosphorylase
LigandBDBM10849
Substrate/Competitorn/a
Meas. Tech.ChEMBL_321348
IC50 648000±n/a nM
Citation Wen, XSun, HLiu, JWu, GZhang, LWu, XNi, P Pentacyclic triterpenes. Part 1: the first examples of naturally occurring pentacyclic triterpenes as a new class of inhibitors of glycogen phosphorylases. Bioorg Med Chem Lett15:4944-8 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Liver glycogen phosphorylase
Name:Liver glycogen phosphorylase
Synonyms:Glycogen phosphorylase, liver form
Type:PROTEIN
Mol. Mass.:97489.46
Organism:Rattus norvegicus
Description:ChEMBL_1491377
Residue:850
Sequence:
MAKPLTDQEKRRQISIRGIVGVENVAELKKGFNRHLHFTLVKDRNVATPRDYYFALAHTV
RDHLVGRWIRTQQHYYDKCPKRVYYLSLEFYMGRTLQNTMINLGLQNACDEAIYQLGLDM
EELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEYGIFNQKIREGWQVEEA
DDWLRHGNPWEKARPEFMLPVHFYGRVEHTQAGTKWVDTQVVLALPYDTPVPGYMNNTVN
TMRLWSARAPNDFNLQDFNVGDYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFV
VAATLQDVIRRFKASKFGSKDGVGTVFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKL
PWSKAWEITKKTFAYTNHTVLPEALERWPVDLVEKLLPRHLQIIYEINQKHLDRIVALFP
KDIDRMRRMSLIEEEGGKRINMAHLCIVGCHAVNGVAKIHSDIVKTQVFKDFSELEPDKF
QNKTNGITPRRWLLLCNPGLADLIAEKIGEDYVKDLSQLTKLHSFVGDDIFLREIAKVKQ
ENKLKFSQFLEKEYKVKINPSSMFDVHVKRIHEYKRQLLNCLHVITMYNRIKKDPKKFFV
PRTVIIGGKAAPGYHMAKMIIKLVTSVAEVVNNDPMVGSKLKVIFLENYRVSLAEKVIPA
TDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRVDDVA
ALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPNQPDLFKDIINMLFYHDRFKVFADYEA
YVKCQEKVSQLYMNQKAWNTMVLRNIAASGKFSSDRTIREYAKDIWNMEPSDLKISLSKE
SSNGVNANGK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10849
NameBDBM10849
Synonyms:1,3,7-trimethyl-2,3,6,7-tetrahydro-1H-purine-2,6-dione | 1,3,7-trimethyl-3,7-dihydropurine-2,6-dione | CHEMBL113 | Caffeine (1,3,7-trimethylxanthine) | caffeine
TypeSmall organic molecule
Emp. Form.C8H10N4O2
Mol. Mass.194.1906
SMILESCn1cnc2n(C)c(=O)n(C)c(=O)c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a