Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD(1A) dopamine receptor
LigandBDBM50180913
Substrate/Competitorn/a
Meas. Tech.ChEMBL_327098
Ki 0.39±n/a nM
Citation Hoefgen, BDecker, MMohr, PSchramm, AMRostom, SAEl-Subbagh, HSchweikert, PMRudolf, DRKassack, MULehmann, J Dopamine/serotonin receptor ligands. 10: SAR Studies on azecine-type dopamine receptor ligands by functional screening at human cloned D1, D2L, and D5 receptors with a microplate reader based calcium assay lead to a novel potent D1/D5 selective antagonist. J Med Chem49:760-9 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
D(1A) dopamine receptor
Name:Dopamine D1 and D2 receptor
Synonyms:DA D1 receptor | DOPAMINE D1 | DRD1 | Dopamine D1 receptor | Dopamine D1 receptor (D1R) | Dopamine D1A
Type:Enzyme
Mol. Mass.:49303.43
Organism:Homo sapiens (Human)
Description:P21728
Residue:446
Sequence:
MRTLNTSAMDGTGLVVERDFSVRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTN
FFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVD
RYWAISSPFRYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTSPSDGNATSLA
ETIDNCDSSLSRTYAISSSVISFYIPVAIMIVTYTRIYRIAQKQIRRIAALERAAVHAKN
CQTTTGNGKPVECSQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCILPFCGS
GETQPFCIDSNTFDVFVWFGWANSSLNPIIYAFNADFRKAFSTLLGCYRLCPATNNAIET
VSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPAL
SVILDYDTDVSLEKIQPITQNGQHPT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50180913
NameBDBM50180913
Synonyms:11-methyl-11-aza-tricyclo[12.4.0.0.3,8]octadeca-1(18),3(8),4,6,14,16-hexaen-6-ol | 11-methyl-11-aza-tricyclo[12.4.0.03,8]octadeca-1(14),3,5,7,15,17-hexaen-6-ol | 3-hydroxy-7-methyl-5,6,7,8,9,14-hexahydrodibenzo[d,g]azecine | 7-methyl-5,6,7,8,9,14-hexahydrodibenzo[d,g]azecin-3-ol | CHEMBL1204122 | CHEMBL201170 | LE404
TypeSmall organic molecule
Emp. Form.C18H21NO
Mol. Mass.267.3654
SMILESCN1CCc2ccccc2Cc2ccc(O)cc2CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a