Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target3-oxoacyl-acyl-carrier protein reductase
LigandBDBM7459
Substrate/Competitorn/a
Meas. Tech.ChEMBL_361112
Ki 800±n/a nM
Citation Tasdemir, DLack, GBrun, RRüedi, PScapozza, LPerozzo, R Inhibition of Plasmodium falciparum fatty acid biosynthesis: evaluation of FabG, FabZ, and FabI as drug targets for flavonoids. J Med Chem49:3345-53 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
3-oxoacyl-acyl-carrier protein reductase
Name:3-oxoacyl-acyl-carrier protein reductase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:33333.53
Organism:Plasmodium falciparum
Description:ChEMBL_675156
Residue:301
Sequence:
MSVLHRFYLFFLFTKFFHCYKISYVLKNAKLAPNHAIKNINSLNLLSENKKENYYYCGEN
KVALVTGAGRGIGREIAKMLAKSVSHVICISRTQKSCDSVVDEIKSFGYESSGYAGDVSK
KEEISEVINKILTEHKNVDILVSNAGITRDNLFLRMKNDEWEDVLRTNLNSLFYITQPIS
KRMINNRYGRIINISSIVGLTGNVGQANYSSSKAGVIGFTKSLAKELASRNITVNAIAPG
FISSDMTDKISEQIKKNIISNIPAGRMGTPEEVANLACFLSSDKSGYINGRVFVIDGGLS
P
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM7459
NameBDBM7459
Synonyms:2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4H-chromen-4-one | 2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-chromen-4-one | CHEMBL151 | Luteolin (27) | Luteolin (4) | cid_5280445 | luteolin
TypeSmall organic molecule
Emp. Form.C15H10O6
Mol. Mass.286.2363
SMILESOc1cc(O)c2c(c1)oc(cc2=O)-c1ccc(O)c(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a