Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAminoglycoside acetyltransferase
LigandBDBM50193475
Substrate/Competitorn/a
Meas. Tech.ChEMBL_385423
Ki 1.2±n/a nM
Citation Gao, FYan, XShakya, TBaettig, OMAit-Mohand-Brunet, SBerghuis, AMWright, GDAuclair, K Synthesis and structure-activity relationships of truncated bisubstrate inhibitors of aminoglycoside 6'-N-acetyltransferases. J Med Chem49:5273-81 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Aminoglycoside acetyltransferase
Name:Aminoglycoside acetyltransferase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:21017.80
Organism:Enterococcus durans
Description:ChEMBL_385423
Residue:183
Sequence:
MIISEFDRDNLVLRDQLADLLRLTWPDEYGEQPMKEVERLLEDERIAVSAIEGDELIGFV
GAIPQYGQTGWELHPLVVESMYRKQQVGTRLVSYLEKEIASQGGIVVYLGTDDVEGQTSL
AIEEDLFEDTFDKLETIQNRKDHPYEFYEKLGYQIVGVIPDANGWNKPDIWMAKRIARKH
GSE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50193475
NameBDBM50193475
Synonyms:(3R)-3-{[2-({2-[({[(1S)-1-carbamoyl-4-[(diaminomethylidene)amino]butyl]carbamoyl}methyl)sulfanyl]ethyl}carbamoyl)ethyl]carbamoyl}-3-hydroxy-2,2-dimethylpropyl ({[(2R,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-4-hydroxy-3-(phosphonatooxy)oxolan-2-yl]methyl phosphonato}oxy)phosphonate | CID44415025 | truncated aminoglycoside-coenzyme A bisubstrate analogue 4c
TypeSmall organic molecule
Emp. Form.C29H47N12O18P3S
Mol. Mass.976.742
SMILES[#6]C([#6])([#6]-[#8]P([#8-])(=O)[#8]P([#8-])(=O)[#8]-[#6]-[#6@H]-1-[#8]-[#6@H](-[#6@H](-[#8])-[#6@@H]-1-[#8]P([#8-])([#8-])=O)-n1cnc2c(-[#7])ncnc12)[#6@@H](-[#8])-[#6](=O)-[#7]-[#6]-[#6]-[#6](=O)-[#7]-[#6]-[#6]-[#16]-[#6]-[#6](=O)-[#7]-[#6@@H](-[#6]-[#6]-[#6]\[#7]=[#6](\[#7])-[#7])-[#6](-[#7])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a