Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEstradiol 17-beta-dehydrogenase 2
LigandBDBM50190030
Substrate/Competitorn/a
Meas. Tech.ChEMBL_398762
IC50 40±n/a nM
Citation Wood, JBagi, CMAkuche, CBacchiocchi, ABaryza, JBlue, MLBrennan, CCampbell, AMChoi, SCook, JHConrad, PDixon, BREhrlich, PPGane, TGunn, DJoe, TJohnson, JSJordan, JKramss, RLiu, PLevy, JLowe, DBMcAlexander, INatero, RRedman, AMScott, WJTown, CWang, MWang, YZhang, Z 4,5-Disubstituted cis-pyrrolidinones as inhibitors of type II 17beta-hydroxysteroid dehydrogenase. Part 3. Identification of lead candidate. Bioorg Med Chem Lett16:4965-8 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Estradiol 17-beta-dehydrogenase 2
Name:Estradiol 17-beta-dehydrogenase 2
Synonyms:17-beta-Hydroxysteroid Dehydrogenase 2 (17-beta-HSD2) | 20 alpha-hydroxysteroid dehydrogenase | 20-alpha-HSD | Estradiol 17-beta-dehydrogenase 2 (17beta-HSD2) | Microsomal 17-beta-hydroxysteroid dehydrogenas | Testosterone 17-beta-dehydrogenase
Type:Oxidoreductase; single-pass type II membrane protein
Mol. Mass.:42795.29
Organism:Homo sapiens (Human)
Description:Enzyme was partially purified from human placenta.
Residue:387
Sequence:
MSTFFSDTAWICLAVPTVLCGTVFCKYKKSSGQLWSWMVCLAGLCAVCLLILSPFWGLIL
FSVSCFLMYTYLSGQELLPVDQKAVLVTGGDCGLGHALCKYLDELGFTVFAGVLNENGPG
AEELRRTCSPRLSVLQMDITKPVQIKDAYSKVAAMLQDRGLWAVINNAGVLGFPTDGELL
LMTDYKQCMAVNFFGTVEVTKTFLPLLRKSKGRLVNVSSMGGGAPMERLASYGSSKAAVT
MFSSVMRLELSKWGIKVASIQPGGFLTNIAGTSDKWEKLEKDILDHLPAEVQEDYGQDYI
LAQRNFLLLINSLASKDFSPVLRDIQHAILAKSPFAYYTPGKGAYLWICLAHYLPIGIYD
YFAKRHFGQDKPMPRALRMPNYKKKAT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50190030
NameBDBM50190030
Synonyms:(4R,5R)-5-((S)-hydroxy(5-(phenylsulfonyl)thiophen-2-yl)methyl)-4-(2-methoxyphenyl)-1-methylpyrrolidin-2-one | CHEMBL215309
TypeSmall organic molecule
Emp. Form.C23H23NO5S2
Mol. Mass.457.562
SMILESCOc1ccccc1[C@H]1CC(=O)N(C)[C@H]1[C@H](O)c1ccc(s1)S(=O)(=O)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a