Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEnoyl-acyl-carrier protein reductase
LigandBDBM8726
Substrate/Competitorn/a
Meas. Tech.ChEMBL_436469
Ki 660±n/a nM
Citation Kumar, GParasuraman, PSharma, SKBanerjee, TKarmodiya, KSurolia, NSurolia, A Discovery of a rhodanine class of compounds as inhibitors of Plasmodium falciparum enoyl-acyl carrier protein reductase. J Med Chem50:2665-75 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Enoyl-acyl-carrier protein reductase
Name:Enoyl-acyl-carrier protein reductase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:49770.86
Organism:Plasmodium falciparum
Description:ChEMBL_795989
Residue:432
Sequence:
MNKISQRLLFLFLHFYTTVCFIQNNTQKTFHNVLQNEQIRGKEKAFYRKEKRENIFIGNK
MKHVHNMNNTHNNNHYMEKEEQDASNINKIKEENKNEDICFIAGIGDTNGYGWGIAKELS
KRNVKIIFGIWPPVYNIFMKNYKNGKFDNDMIIDKDKKMNILDMLPFDASFDTANDIDEE
TKNNKRYNMLQNYPIEDVANLIHQKYGKINMLVHSLANAKEVQKDLLNTSRKGYLDALSK
SSYSLISLCKYFVNIMKPQSSIISLTYHASQKVVPGYGGGMSSAKAALESDTRVLAYHLG
RNYNIRINTISAGPLKSRAATAINKLNNTYENNTNQNKNRNSHDVHNIMNNSGEKEEKKN
SASQNYTFIDYAIEYSEKYAPLRQKLLSTDIGSVASFLLSRESRAITGQTIYVDNGLNIM
FLPDDIYRNENE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM8726
NameBDBM8726
Synonyms:5-chloro-2-(2,4-dichlorophenoxy)phenol | CHEMBL849 | TCL | Triclosan
TypeSmall organic molecule
Emp. Form.C12H7Cl3O2
Mol. Mass.289.542
SMILESOc1cc(Cl)ccc1Oc1ccc(Cl)cc1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a